BLASTX nr result
ID: Mentha25_contig00046637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00046637 (550 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU76195.1| /Sialidase superfamily/BNR/Asp-box repeat protei... 61 2e-07 gb|EPQ64390.1| hypothetical protein BGT96224_5010 [Blumeria gram... 61 2e-07 >emb|CCU76195.1| /Sialidase superfamily/BNR/Asp-box repeat protein [Blumeria graminis f. sp. hordei DH14] Length = 368 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +1 Query: 1 KLLTSKDGGGTWSKTTIFQEPSFWPGLLVLNTKNSFLYLAGFNGL 135 KLLTS D G W K+T+F+ P+FWPGL VL + +FLY+AG +G+ Sbjct: 315 KLLTSTDNGANWVKSTVFKAPAFWPGLTVLRDEKTFLYMAGSDGV 359 >gb|EPQ64390.1| hypothetical protein BGT96224_5010 [Blumeria graminis f. sp. tritici 96224] Length = 368 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 1 KLLTSKDGGGTWSKTTIFQEPSFWPGLLVLNTKNSFLYLAGFNGL 135 KLLTS D G W K+T+F+ P+FWPGL VL + +FLY+AG G+ Sbjct: 315 KLLTSTDNGANWVKSTVFKAPAFWPGLTVLQDEKTFLYMAGSEGV 359