BLASTX nr result
ID: Mentha25_contig00046613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00046613 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27514.1| hypothetical protein MIMGU_mgv1a002867mg [Mimulus... 114 2e-23 >gb|EYU27514.1| hypothetical protein MIMGU_mgv1a002867mg [Mimulus guttatus] Length = 629 Score = 114 bits (284), Expect = 2e-23 Identities = 56/98 (57%), Positives = 76/98 (77%) Frame = -3 Query: 333 DDEAELVKEQQNSDNDLQQKNDEKKEVASSGMEDTLVSEDYVDLVKHCKFVNVPTRARSS 154 +DEAE+VK+++N DNDLQQK+DE K V ED+ DL+KHCKFVNVPT+ARSS Sbjct: 239 NDEAEMVKDRRN-DNDLQQKHDETK-----------VREDHTDLLKHCKFVNVPTKARSS 286 Query: 153 LTIKGSKGDRNPIKEDQSTSKSEPLEDSGVHIIDVDIE 40 LT+KGSKG+++P+ E+ SK + LE SGVH++DVD++ Sbjct: 287 LTVKGSKGEKDPMNENVDFSKKQHLESSGVHVLDVDVK 324