BLASTX nr result
ID: Mentha25_contig00046447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00046447 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25169.1| hypothetical protein MIMGU_mgv1a010164mg [Mimulus... 101 9e-20 gb|EYU19604.1| hypothetical protein MIMGU_mgv1a013544mg [Mimulus... 65 1e-08 >gb|EYU25169.1| hypothetical protein MIMGU_mgv1a010164mg [Mimulus guttatus] Length = 320 Score = 101 bits (252), Expect = 9e-20 Identities = 60/126 (47%), Positives = 77/126 (61%), Gaps = 9/126 (7%) Frame = -1 Query: 365 DEETDGEDSFFDLVLKSPDSVALTRRDVAAEKDFRFVR--------RDDFVSSKPLYKVT 210 D+E E++FFDL KS R AA KDF+F+ + DF +SK L VT Sbjct: 35 DDEAGKEEAFFDLDFKS-------ERGDAASKDFQFIESPRDVFLSKSDFSNSKSLSPVT 87 Query: 209 LVRSTPRLRVFMLGFRKSSKFEKSE-TYGEARWSPLKQFPKSSKSEESNRVSVTCRVEKT 33 +RS P+ +VFMLGF+KSSKFEK+E + GE + SPL Q KSSK E+SNR S+ CRV + Sbjct: 88 TLRSAPKFKVFMLGFKKSSKFEKTELSNGETKASPLNQLSKSSKLEQSNRFSLKCRVAEA 147 Query: 32 PVTCRA 15 P A Sbjct: 148 PAASPA 153 >gb|EYU19604.1| hypothetical protein MIMGU_mgv1a013544mg [Mimulus guttatus] Length = 217 Score = 64.7 bits (156), Expect = 1e-08 Identities = 41/96 (42%), Positives = 53/96 (55%), Gaps = 2/96 (2%) Frame = -1 Query: 347 EDSFFDLVLKSPDSVALTRRDVAAEKDFRFVRRD-DFVSSKPLYKVTLVRSTPRLRVFML 171 E SFFDLV+KSPD A R A+KD F+ D +K VT + S + +VF+L Sbjct: 20 EASFFDLVVKSPDGAAAGRGGGVAKKDLEFIESPTDVFPTKNSSPVTPLPSATKFKVFIL 79 Query: 170 GFRKSSKFEKSETYGE-ARWSPLKQFPKSSKSEESN 66 GFRK SK EK+E+ GE +SP P E S+ Sbjct: 80 GFRKLSKCEKTESNGELTGFSPANPIPNHLLKEASD 115