BLASTX nr result
ID: Mentha25_contig00045920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00045920 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW86884.1| isopiperitenone reductase [Mentha x piperita] 72 6e-11 sp|Q6WAU1.1|IPIPR_MENPI RecName: Full=(-)-isopiperitenone reduct... 72 6e-11 gb|ABR15425.1| (-)-isopiperitenone reductase [Mentha canadensis] 71 1e-10 >gb|ABW86884.1| isopiperitenone reductase [Mentha x piperita] Length = 314 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 340 TFHAGPLSVSEAAQVPVKLALLPDVGPSGCFFPRDE 233 TFHAGPLSV+EAAQVPVKLALLPD GPSGCFFPRD+ Sbjct: 274 TFHAGPLSVAEAAQVPVKLALLPDGGPSGCFFPRDK 309 >sp|Q6WAU1.1|IPIPR_MENPI RecName: Full=(-)-isopiperitenone reductase gi|34559416|gb|AAQ75422.1| (-)-isopiperitenone reductase [Mentha x piperita] Length = 314 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 340 TFHAGPLSVSEAAQVPVKLALLPDVGPSGCFFPRDE 233 TFHAGPLSV+EAAQVPVKLALLPD GPSGCFFPRD+ Sbjct: 274 TFHAGPLSVAEAAQVPVKLALLPDGGPSGCFFPRDK 309 >gb|ABR15425.1| (-)-isopiperitenone reductase [Mentha canadensis] Length = 314 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 340 TFHAGPLSVSEAAQVPVKLALLPDVGPSGCFFPRDE 233 TFHAGPLSVSEAAQVPVKLALLPD GPSGCF PRD+ Sbjct: 274 TFHAGPLSVSEAAQVPVKLALLPDGGPSGCFLPRDK 309