BLASTX nr result
ID: Mentha25_contig00045759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00045759 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469587.1| PREDICTED: probable lipid-A-disaccharide syn... 56 6e-06 ref|XP_006447675.1| hypothetical protein CICLE_v10018214mg [Citr... 56 6e-06 >ref|XP_006469587.1| PREDICTED: probable lipid-A-disaccharide synthase, mitochondrial-like isoform X1 [Citrus sinensis] Length = 471 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 345 SSPSGSKIISVLPGSRLQEVTRMLPIFIRTLELLK 449 S PSG+ IIS+LPGSRLQEV RMLPIF +T+ELLK Sbjct: 251 SVPSGAMIISLLPGSRLQEVARMLPIFAKTMELLK 285 >ref|XP_006447675.1| hypothetical protein CICLE_v10018214mg [Citrus clementina] gi|557550286|gb|ESR60915.1| hypothetical protein CICLE_v10018214mg [Citrus clementina] Length = 443 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 345 SSPSGSKIISVLPGSRLQEVTRMLPIFIRTLELLK 449 S PSG+ IIS+LPGSRLQEV RMLPIF +T+ELLK Sbjct: 223 SVPSGAMIISLLPGSRLQEVARMLPIFAKTMELLK 257