BLASTX nr result
ID: Mentha25_contig00045506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00045506 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28162.1| hypothetical protein MIMGU_mgv1a013717mg [Mimulus... 65 1e-08 >gb|EYU28162.1| hypothetical protein MIMGU_mgv1a013717mg [Mimulus guttatus] Length = 212 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/71 (50%), Positives = 42/71 (59%) Frame = +1 Query: 19 ILDPKECATQENDDRSTSSCIDSRAAINNGAQHAKDXXXXXXXXXXXXXXXQKTSWKSCC 198 ILDPK+C TQEN DR T RA +N A++ K QKTSWKSCC Sbjct: 144 ILDPKKCVTQENGDRLTLLPNAPRANDDNEAENEKGVTEPLLVPSPLPV--QKTSWKSCC 201 Query: 199 GLFEVFAGSGA 231 GLFEVF+GSG+ Sbjct: 202 GLFEVFSGSGS 212