BLASTX nr result
ID: Mentha25_contig00045364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00045364 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41995.1| hypothetical protein MIMGU_mgv1a012823mg [Mimulus... 62 1e-07 >gb|EYU41995.1| hypothetical protein MIMGU_mgv1a012823mg [Mimulus guttatus] Length = 239 Score = 61.6 bits (148), Expect = 1e-07 Identities = 36/74 (48%), Positives = 43/74 (58%), Gaps = 1/74 (1%) Frame = +2 Query: 2 DPLSTPE-YVRKRRRFSSWGSSFDGRAAVADHRRDGNGVRSSRLCFAIXXXXXXXXXXXX 178 DP+STP YVRKRRRFSSWGSSFD RA+ R+ + + CF I Sbjct: 162 DPISTPNAYVRKRRRFSSWGSSFDDRASAISSVRNDDVSPPANSCFGI--GKDKSDGGYS 219 Query: 179 ALVVKRALLSIVGR 220 +VK+A LSIVGR Sbjct: 220 VFIVKKAFLSIVGR 233