BLASTX nr result
ID: Mentha25_contig00045296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00045296 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007019619.1| S-adenosylmethionine carrier 2 [Theobroma ca... 62 8e-08 ref|XP_006434531.1| hypothetical protein CICLE_v10001842mg [Citr... 60 4e-07 ref|XP_002306360.2| mitochondrial substrate carrier family prote... 59 9e-07 ref|XP_006473127.1| PREDICTED: S-adenosylmethionine carrier 1, c... 58 1e-06 ref|XP_006473126.1| PREDICTED: S-adenosylmethionine carrier 1, c... 58 1e-06 ref|XP_006473125.1| PREDICTED: S-adenosylmethionine carrier 1, c... 58 1e-06 ref|XP_006473124.1| PREDICTED: S-adenosylmethionine carrier 1, c... 58 1e-06 ref|XP_006303640.1| hypothetical protein CARUB_v10011601mg [Caps... 58 1e-06 gb|AAY34159.1| At1g34065 [Arabidopsis thaliana] gi|117585042|emb... 58 1e-06 ref|XP_002893808.1| At1g34065 [Arabidopsis lyrata subsp. lyrata]... 58 1e-06 ref|NP_564436.4| S-adenosylmethionine carrier 2 [Arabidopsis tha... 58 1e-06 gb|EXB24794.1| hypothetical protein L484_005173 [Morus notabilis] 58 2e-06 ref|XP_006441382.1| hypothetical protein CICLE_v10021207mg [Citr... 58 2e-06 ref|XP_004496430.1| PREDICTED: S-adenosylmethionine mitochondria... 58 2e-06 ref|XP_004172350.1| PREDICTED: uncharacterized mitochondrial car... 58 2e-06 ref|XP_004148454.1| PREDICTED: uncharacterized mitochondrial car... 58 2e-06 gb|EXC35977.1| S-adenosylmethionine mitochondrial carrier protei... 57 2e-06 ref|XP_006466113.1| PREDICTED: S-adenosylmethionine carrier 1, c... 57 3e-06 ref|XP_002307518.2| hypothetical protein POPTR_0005s21910g [Popu... 57 3e-06 ref|XP_004288103.1| PREDICTED: S-adenosylmethionine mitochondria... 57 3e-06 >ref|XP_007019619.1| S-adenosylmethionine carrier 2 [Theobroma cacao] gi|508724947|gb|EOY16844.1| S-adenosylmethionine carrier 2 [Theobroma cacao] Length = 326 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKNRDSLK 297 G+G RV+WIG+GGSIFFGVLEKTKQ+LA RRP + S K Sbjct: 284 GIGPRVLWIGLGGSIFFGVLEKTKQMLAERRPENQKSFSFK 324 >ref|XP_006434531.1| hypothetical protein CICLE_v10001842mg [Citrus clementina] gi|557536653|gb|ESR47771.1| hypothetical protein CICLE_v10001842mg [Citrus clementina] Length = 323 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKNRDSLKL 294 GMG RV+WIGIGGSIFFGVLEKTK++LA R ++ S KL Sbjct: 281 GMGRRVLWIGIGGSIFFGVLEKTKEVLAQRHFNSQDSSSFKL 322 >ref|XP_002306360.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550338430|gb|EEE93356.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 312 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRP 324 G+G RV+WIGIGGSIFFGVLE+TK+LLA RRP Sbjct: 270 GIGPRVLWIGIGGSIFFGVLERTKRLLAQRRP 301 >ref|XP_006473127.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X4 [Citrus sinensis] gi|568838251|ref|XP_006473128.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X5 [Citrus sinensis] Length = 276 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKNRDSLKL 294 GMG RV+WIGIGGSIFFGVLEKTK +LA R ++ S KL Sbjct: 234 GMGPRVLWIGIGGSIFFGVLEKTKVVLAQRHFNSQDSSSFKL 275 >ref|XP_006473126.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X3 [Citrus sinensis] Length = 323 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKNRDSLKL 294 GMG RV+WIGIGGSIFFGVLEKTK +LA R ++ S KL Sbjct: 281 GMGPRVLWIGIGGSIFFGVLEKTKVVLAQRHFNSQDSSSFKL 322 >ref|XP_006473125.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X2 [Citrus sinensis] Length = 330 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKNRDSLKL 294 GMG RV+WIGIGGSIFFGVLEKTK +LA R ++ S KL Sbjct: 288 GMGPRVLWIGIGGSIFFGVLEKTKVVLAQRHFNSQDSSSFKL 329 >ref|XP_006473124.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X1 [Citrus sinensis] Length = 331 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKNRDSLKL 294 GMG RV+WIGIGGSIFFGVLEKTK +LA R ++ S KL Sbjct: 289 GMGPRVLWIGIGGSIFFGVLEKTKVVLAQRHFNSQDSSSFKL 330 >ref|XP_006303640.1| hypothetical protein CARUB_v10011601mg [Capsella rubella] gi|482572351|gb|EOA36538.1| hypothetical protein CARUB_v10011601mg [Capsella rubella] Length = 271 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKN 312 GMG RV+WIGIGGSIFFGVLEKTKQ+L+ R + N Sbjct: 235 GMGPRVLWIGIGGSIFFGVLEKTKQILSERSQKSHN 270 >gb|AAY34159.1| At1g34065 [Arabidopsis thaliana] gi|117585042|emb|CAJ91124.1| S-adenosylmethionine carrier [Arabidopsis thaliana] Length = 321 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKN 312 GMG RV+WIGIGGSIFFGVLEKTKQ+L+ R + N Sbjct: 285 GMGPRVLWIGIGGSIFFGVLEKTKQILSERSQKSHN 320 >ref|XP_002893808.1| At1g34065 [Arabidopsis lyrata subsp. lyrata] gi|297339650|gb|EFH70067.1| At1g34065 [Arabidopsis lyrata subsp. lyrata] Length = 321 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKN 312 GMG RV+WIGIGGSIFFGVLEKTKQ+L+ R + N Sbjct: 285 GMGPRVLWIGIGGSIFFGVLEKTKQILSERSQKSHN 320 >ref|NP_564436.4| S-adenosylmethionine carrier 2 [Arabidopsis thaliana] gi|565830531|sp|F4HT41.1|SAMC2_ARATH RecName: Full=Probable S-adenosylmethionine carrier 2, chloroplastic; Flags: Precursor gi|332193547|gb|AEE31668.1| S-adenosylmethionine carrier 2 [Arabidopsis thaliana] Length = 345 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKN 312 GMG RV+WIGIGGSIFFGVLEKTKQ+L+ R + N Sbjct: 309 GMGPRVLWIGIGGSIFFGVLEKTKQILSERSQKSHN 344 >gb|EXB24794.1| hypothetical protein L484_005173 [Morus notabilis] Length = 213 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRP 324 G+G RV+WIGIGGSIFFGVLE TK+LLA RRP Sbjct: 173 GIGPRVLWIGIGGSIFFGVLESTKRLLAQRRP 204 >ref|XP_006441382.1| hypothetical protein CICLE_v10021207mg [Citrus clementina] gi|567897790|ref|XP_006441383.1| hypothetical protein CICLE_v10021207mg [Citrus clementina] gi|557543644|gb|ESR54622.1| hypothetical protein CICLE_v10021207mg [Citrus clementina] gi|557543645|gb|ESR54623.1| hypothetical protein CICLE_v10021207mg [Citrus clementina] Length = 320 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRP 324 G+G RV+WIGIGGSIFFGVLE+TK++LA RRP Sbjct: 280 GIGPRVMWIGIGGSIFFGVLERTKRMLAQRRP 311 >ref|XP_004496430.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like isoform X1 [Cicer arietinum] gi|502118889|ref|XP_004496431.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like isoform X2 [Cicer arietinum] Length = 296 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPR 321 G+G RV+WIGIGGSIFFGVLEKTK++LA R+P+ Sbjct: 259 GIGPRVLWIGIGGSIFFGVLEKTKKILAQRQPQ 291 >ref|XP_004172350.1| PREDICTED: uncharacterized mitochondrial carrier C12B10.09-like, partial [Cucumis sativus] Length = 247 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRP 324 G+G RV+WIGIGGSIFFGVLE TK+LLA RRP Sbjct: 207 GIGPRVLWIGIGGSIFFGVLESTKRLLAERRP 238 >ref|XP_004148454.1| PREDICTED: uncharacterized mitochondrial carrier C12B10.09-like [Cucumis sativus] Length = 306 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRP 324 G+G RV+WIGIGGSIFFGVLE TK+LLA RRP Sbjct: 266 GIGPRVLWIGIGGSIFFGVLESTKRLLAERRP 297 >gb|EXC35977.1| S-adenosylmethionine mitochondrial carrier protein [Morus notabilis] Length = 277 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGKNRDSLK 297 G RV+WIGIGGSIFFGVLE+TKQ+LA RRP + S K Sbjct: 235 GTAPRVLWIGIGGSIFFGVLERTKQMLAQRRPPLEKSSSFK 275 >ref|XP_006466113.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X1 [Citrus sinensis] gi|568823423|ref|XP_006466114.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X2 [Citrus sinensis] gi|568823425|ref|XP_006466115.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X3 [Citrus sinensis] gi|568823427|ref|XP_006466116.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X4 [Citrus sinensis] gi|568823429|ref|XP_006466117.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like isoform X5 [Citrus sinensis] Length = 320 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRP 324 G+G RV+WIGIGGSIFFGVLE TK++LA RRP Sbjct: 280 GIGPRVMWIGIGGSIFFGVLESTKRMLAQRRP 311 >ref|XP_002307518.2| hypothetical protein POPTR_0005s21910g [Populus trichocarpa] gi|550339493|gb|EEE94514.2| hypothetical protein POPTR_0005s21910g [Populus trichocarpa] Length = 302 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPRGK 315 G+G RV+WIG+GG+IFFGVLEKTKQ+LA R P K Sbjct: 267 GIGPRVLWIGVGGAIFFGVLEKTKQILAQRCPEPK 301 >ref|XP_004288103.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like [Fragaria vesca subsp. vesca] Length = 327 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 419 GMGARVVWIGIGGSIFFGVLEKTKQLLAHRRPR 321 G+G RV+WIGIGGSIFFGVLE+TK+LLA RP+ Sbjct: 287 GIGPRVLWIGIGGSIFFGVLERTKRLLAQSRPK 319