BLASTX nr result
ID: Mentha25_contig00043917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00043917 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001938962.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001938455.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001937183.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001942496.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001933845.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001942374.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001941679.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001940750.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001940426.1| predicted protein [Pyrenophora tritici-repen... 72 8e-11 ref|XP_001940351.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001939997.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001932438.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001931203.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001937846.1| hypothetical protein PTRG_07514 [Pyrenophora... 70 4e-10 ref|XP_001936310.1| conserved hypothetical protein [Pyrenophora ... 70 4e-10 ref|XP_001935883.1| conserved hypothetical protein [Pyrenophora ... 70 4e-10 ref|XP_001942468.1| predicted protein [Pyrenophora tritici-repen... 70 4e-10 ref|XP_001942128.1| conserved hypothetical protein [Pyrenophora ... 70 4e-10 ref|XP_001933438.1| conserved hypothetical protein [Pyrenophora ... 70 4e-10 ref|XP_001933059.1| conserved hypothetical protein [Pyrenophora ... 70 4e-10 >ref|XP_001938962.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187986061|gb|EDU51549.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 930 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 871 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 928 >ref|XP_001938455.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985554|gb|EDU51042.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1043 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 984 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 1041 >ref|XP_001937183.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984282|gb|EDU49770.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1396 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 1337 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 1394 >ref|XP_001942496.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187982720|gb|EDU48208.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|308525071|gb|ADO33889.1| polyprotein [Pyrenophora tritici-repentis] gi|545289850|gb|AGW27431.1| polyprotein [Pyrenophora tritici-repentis] Length = 1716 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 1657 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 1714 >ref|XP_001933845.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979724|gb|EDU46350.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1520 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 1461 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 1518 >ref|XP_001942374.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979573|gb|EDU46199.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 116 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 57 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 114 >ref|XP_001941679.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977772|gb|EDU44398.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 349 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 290 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 347 >ref|XP_001940750.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976843|gb|EDU43469.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 386 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 327 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 384 >ref|XP_001940426.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976519|gb|EDU43145.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 346 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 287 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 344 >ref|XP_001940351.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976444|gb|EDU43070.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 979 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 920 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 977 >ref|XP_001939997.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976090|gb|EDU42716.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1619 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 1560 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 1617 >ref|XP_001932438.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187974044|gb|EDU41543.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1569 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 1510 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 1567 >ref|XP_001931203.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|189203571|ref|XP_001938121.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|189208860|ref|XP_001940763.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972809|gb|EDU40308.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976856|gb|EDU43482.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985220|gb|EDU50708.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1591 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK +PN AL+RF++SN+LS+R+EGSV RP Sbjct: 1532 IMALRQSYERREITEIRWINGEDNPADAFTKATPNRALERFIESNKLSIRVEGSVQRP 1589 >ref|XP_001937846.1| hypothetical protein PTRG_07514 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984945|gb|EDU50433.1| hypothetical protein PTRG_07514 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 434 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK SPN AL+RF+D N+L+VR+EG V RP Sbjct: 372 IMALRQSYERREITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRP 429 >ref|XP_001936310.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983409|gb|EDU48897.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1375 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK SPN AL+RF+D N+L+VR+EG V RP Sbjct: 1313 IMALRQSYERREITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRP 1370 >ref|XP_001935883.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187982982|gb|EDU48470.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1518 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK SPN AL+RF+D N+L+VR+EG V RP Sbjct: 1456 IMALRQSYERREITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRP 1513 >ref|XP_001942468.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980704|gb|EDU47330.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 201 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK SPN AL+RF+D N+L+VR+EG V RP Sbjct: 139 IMALRQSYERREITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRP 196 >ref|XP_001942128.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979327|gb|EDU45953.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1504 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK SPN AL+RF+D N+L+VR+EG V RP Sbjct: 1442 IMALRQSYERREITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRP 1499 >ref|XP_001933438.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979002|gb|EDU45628.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1426 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK SPN AL+RF+D N+L+VR+EG V RP Sbjct: 1364 IMALRQSYERREITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRP 1421 >ref|XP_001933059.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978623|gb|EDU45249.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1442 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = +2 Query: 2 VMALRQSYXXXXXXXXXXXNGADNPADGMTKTSPNHALKRFVDSNRLSVRMEGSVNRP 175 +MALRQSY NG DNPAD TK SPN AL+RF+D N+L+VR+EG V RP Sbjct: 1380 IMALRQSYERREITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRP 1437