BLASTX nr result
ID: Mentha25_contig00042438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00042438 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23551.1| hypothetical protein MIMGU_mgv1a001433mg [Mimulus... 74 2e-11 gb|EYU23550.1| hypothetical protein MIMGU_mgv1a023623mg, partial... 68 1e-09 ref|XP_007021503.1| Nbs-lrr resistance protein [Theobroma cacao]... 55 8e-06 >gb|EYU23551.1| hypothetical protein MIMGU_mgv1a001433mg [Mimulus guttatus] Length = 820 Score = 73.9 bits (180), Expect = 2e-11 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 3/101 (2%) Frame = -2 Query: 346 SCLKRLVIKNCNKLRKVGFPISGAPNLECIDIRXXXXXXXXXXXXXGRGSI---TVPKLK 176 S LK L I CNK++K+G P S PNLE + I+ G+I ++PKLK Sbjct: 660 SSLKSLWISECNKMKKLGLPASELPNLETLSIKKCSDIEEIIEDAEEGGNIPTISLPKLK 719 Query: 175 KLSLYDLPRLERVCNATMFCKSISEVFIVKCPRLMNKLPVH 53 L LY LPRL +CN TM C SI + + C L+ K+P++ Sbjct: 720 WLELYKLPRLRSICNTTMVCDSIHMISLSSC-LLLKKVPLY 759 >gb|EYU23550.1| hypothetical protein MIMGU_mgv1a023623mg, partial [Mimulus guttatus] Length = 610 Score = 67.8 bits (164), Expect = 1e-09 Identities = 41/103 (39%), Positives = 59/103 (57%), Gaps = 3/103 (2%) Frame = -2 Query: 352 VFSCLKRLVIKNCNKLRKVGFPISGAPNLECIDIRXXXXXXXXXXXXXG---RGSITVPK 182 VFS L+RL I CNK++K+G S PNLE I I+ ++++PK Sbjct: 456 VFSSLRRLNIFYCNKMKKLGLLGSDFPNLEEIRIKGCPDIEDIIVQAVEAEGEENVSLPK 515 Query: 181 LKKLSLYDLPRLERVCNATMFCKSISEVFIVKCPRLMNKLPVH 53 LK L L +LPRL+ +C ATM C SI + + CP L+ K+P++ Sbjct: 516 LKTLELRNLPRLKSICKATMNCGSIERIELWGCP-LLKKVPLY 557 >ref|XP_007021503.1| Nbs-lrr resistance protein [Theobroma cacao] gi|508721131|gb|EOY13028.1| Nbs-lrr resistance protein [Theobroma cacao] Length = 678 Score = 55.5 bits (132), Expect = 8e-06 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 11/115 (9%) Frame = -2 Query: 364 RTIAVFSCLKRLVIKNCNKLRKV---GFPISGAPNLECIDIRXXXXXXXXXXXXXGRGS- 197 +T FS LK + + +C KL+ + + + NLE I++R S Sbjct: 509 QTPVTFSSLKVIYLTSCGKLKNLLPAKWVLQNLQNLEEIEVRNCERMEEIIASEKEGMST 568 Query: 196 -----ITVPKLKKLSLYDLPRLERVC--NATMFCKSISEVFIVKCPRLMNKLPVH 53 T+PKL+KL LY+LP L+ +C N M C S+ + I+ CP+L ++P+H Sbjct: 569 KNNVMFTLPKLRKLKLYNLPELKSICKTNEVMACDSLQGIEIMYCPKL-KRIPIH 622