BLASTX nr result
ID: Mentha25_contig00042419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00042419 (831 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU74171.1| hypothetical protein BGHDH14_bghG000032000001001... 74 7e-11 >emb|CCU74171.1| hypothetical protein BGHDH14_bghG000032000001001 [Blumeria graminis f. sp. hordei DH14] Length = 133 Score = 73.9 bits (180), Expect = 7e-11 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -2 Query: 515 AHSVPAWGEYKLNSQYPPWPSRPCADYGAYACFRPQRQQDLTNSK 381 A VPAWGEYKLN+QYPPWPSRPCAD+GA ACF ++DL S+ Sbjct: 19 ATPVPAWGEYKLNTQYPPWPSRPCADFGASACFDADGREDLLVSR 63