BLASTX nr result
ID: Mentha25_contig00042250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00042250 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18251.1| hypothetical protein MIMGU_mgv1a009013mg [Mimulus... 69 5e-10 >gb|EYU18251.1| hypothetical protein MIMGU_mgv1a009013mg [Mimulus guttatus] Length = 355 Score = 69.3 bits (168), Expect = 5e-10 Identities = 40/72 (55%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 56 EKEFSFFPLESAHNMNWLHRSNPSEESENQSAELVSRKRKLSFSGG-IGNDQFFWSQD-S 229 EK+FSFFP+ESA S E ENQS ++VSRKRK F+ I NDQF WSQD S Sbjct: 292 EKQFSFFPMESAFK---------SRERENQSVDIVSRKRKQPFNAADIENDQFLWSQDSS 342 Query: 230 TNHFVGQMRRPG 265 +N F Q RRPG Sbjct: 343 SNKFADQTRRPG 354