BLASTX nr result
ID: Mentha25_contig00042209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00042209 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40887.1| hypothetical protein MIMGU_mgv1a005893mg [Mimulus... 64 3e-08 >gb|EYU40887.1| hypothetical protein MIMGU_mgv1a005893mg [Mimulus guttatus] Length = 466 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/39 (84%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = -3 Query: 115 TPFLRPSAFHLKPRS-TRLPVVRAKIREIFMPALSSTMT 2 T F+RPSAF LKPRS +RLP+VRAKIREIFMPALSSTMT Sbjct: 14 TQFIRPSAFFLKPRSLSRLPLVRAKIREIFMPALSSTMT 52