BLASTX nr result
ID: Mentha25_contig00041229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00041229 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44305.1| hypothetical protein MIMGU_mgv1a003952mg [Mimulus... 59 5e-07 >gb|EYU44305.1| hypothetical protein MIMGU_mgv1a003952mg [Mimulus guttatus] Length = 552 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +3 Query: 255 ESEEYARQRITRIYKILKYSTWDSAKEELENLSWKWDS 368 E + Y+R++IT+IY ILKYSTWDSA+E+L+NL KWDS Sbjct: 38 EPKIYSREKITKIYNILKYSTWDSAQEQLDNLPTKWDS 75