BLASTX nr result
ID: Mentha25_contig00041142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00041142 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31736.1| hypothetical protein MIMGU_mgv1a023294mg [Mimulus... 57 2e-06 >gb|EYU31736.1| hypothetical protein MIMGU_mgv1a023294mg [Mimulus guttatus] Length = 931 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/75 (45%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = -2 Query: 360 LETVRELIDDETKFLVHGSDEVEQAKRDLNKIHDMLMKADA-DRRHSPPALKVCVAGLRD 184 L+T+R+L+ +ET+FL SD VE+ +R+LN IH +LM AD +H L+ A L + Sbjct: 10 LQTIRDLLVEETRFLYGVSDAVEKVERELNTIHCILMDADKWQDKHKTAILRDWTAQLNE 69 Query: 183 LAFVAEDALVAYAVE 139 LA AE L YAVE Sbjct: 70 LASRAEYVLEKYAVE 84