BLASTX nr result
ID: Mentha25_contig00040873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040873 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28572.1| hypothetical protein MIMGU_mgv1a009808mg [Mimulus... 62 1e-07 >gb|EYU28572.1| hypothetical protein MIMGU_mgv1a009808mg [Mimulus guttatus] Length = 331 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 103 MGAGEEGTPSKSAKPQSSAQETPATPMTPVYPDW 2 MGAGEE TP+KS+KP SSA ETP TP TP YPDW Sbjct: 1 MGAGEESTPTKSSKPASSANETPVTPSTPAYPDW 34