BLASTX nr result
ID: Mentha25_contig00040818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040818 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35877.1| hypothetical protein MIMGU_mgv1a006299mg [Mimulus... 75 7e-12 >gb|EYU35877.1| hypothetical protein MIMGU_mgv1a006299mg [Mimulus guttatus] Length = 449 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 1/55 (1%) Frame = +3 Query: 186 EVITKASASIPT-PTEEETNFPIVLNPEPIFLKLKPESDGAEAQNSVKKVTGWEL 347 E+ITKAS+SI T PT++E+N+PIVLNP+PIFLKLKPESD N VKK+TGWE+ Sbjct: 47 ELITKASSSIQTLPTDDESNYPIVLNPDPIFLKLKPESDD---PNPVKKLTGWEI 98