BLASTX nr result
ID: Mentha25_contig00040692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040692 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44383.1| hypothetical protein MIMGU_mgv1a024495mg [Mimulus... 66 6e-09 gb|EYU30586.1| hypothetical protein MIMGU_mgv1a019027mg, partial... 57 3e-06 >gb|EYU44383.1| hypothetical protein MIMGU_mgv1a024495mg [Mimulus guttatus] Length = 374 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/65 (52%), Positives = 44/65 (67%), Gaps = 7/65 (10%) Frame = -3 Query: 297 LNGRGMFVGINHSFAISASHNGELKPNSIYFTDSKRI-------KRVRGLNDNGVFDYET 139 L+G +F+GINH FAISA+ +L PNSIYFTDSK R G +DNGVF+Y+T Sbjct: 283 LDGLAIFIGINHGFAISAAEELKLSPNSIYFTDSKEYCPRYWDKDREYGGHDNGVFNYKT 342 Query: 138 KTIST 124 +T S+ Sbjct: 343 RTFSS 347 >gb|EYU30586.1| hypothetical protein MIMGU_mgv1a019027mg, partial [Mimulus guttatus] Length = 344 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 8/69 (11%) Frame = -3 Query: 297 LNGRGMFVGINHSFAISASHN-GELKPNSIYFTDSKRI-------KRVRGLNDNGVFDYE 142 L+G +FVG NHSFA+ A+ + ELKPNSIYFTDS + K G++D G++DY+ Sbjct: 250 LDGLSLFVGGNHSFALPAAGDYPELKPNSIYFTDSLGLQYFNTDTKEPYGVHDIGIYDYQ 309 Query: 141 TKTISTPSY 115 TIS P Y Sbjct: 310 DGTIS-PCY 317