BLASTX nr result
ID: Mentha25_contig00040652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040652 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35144.1| hypothetical protein MIMGU_mgv1a008117mg [Mimulus... 51 6e-06 >gb|EYU35144.1| hypothetical protein MIMGU_mgv1a008117mg [Mimulus guttatus] Length = 384 Score = 50.8 bits (120), Expect(2) = 6e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 66 IDVHAGLEKGKGFKEQLNYLNPKDMRIPKVEPL 164 I VHAGLEK KG +EQLNYL KD RI KVEPL Sbjct: 285 IAVHAGLEKDKGVEEQLNYLKNKDTRISKVEPL 317 Score = 24.6 bits (52), Expect(2) = 6e-06 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 160 LCGRKNVWEIPK 195 L GRKNVW IP+ Sbjct: 317 LSGRKNVWNIPE 328