BLASTX nr result
ID: Mentha25_contig00040593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040593 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41177.1| hypothetical protein MIMGU_mgv1a008261mg [Mimulus... 64 2e-08 ref|XP_004289620.1| PREDICTED: UPF0496 protein At4g34320-like [F... 64 2e-08 gb|EYU37760.1| hypothetical protein MIMGU_mgv1a008357mg [Mimulus... 63 4e-08 ref|XP_007201071.1| hypothetical protein PRUPE_ppa007273mg [Prun... 63 4e-08 ref|XP_002313064.1| hypothetical protein POPTR_0009s11550g [Popu... 63 4e-08 ref|XP_006365509.1| PREDICTED: UPF0496 protein At4g34320-like [S... 63 5e-08 ref|XP_002306083.1| hypothetical protein POPTR_0004s15800g [Popu... 63 5e-08 ref|XP_006423198.1| hypothetical protein CICLE_v10030403mg [Citr... 62 6e-08 ref|XP_007131859.1| hypothetical protein PHAVU_011G047500g [Phas... 62 8e-08 ref|XP_004230936.1| PREDICTED: UPF0496 protein At4g34320-like is... 62 1e-07 gb|AFK35357.1| unknown [Medicago truncatula] 62 1e-07 ref|XP_006412240.1| hypothetical protein EUTSA_v100255250mg, par... 61 1e-07 ref|XP_004148297.1| PREDICTED: UPF0496 protein At4g34320-like [C... 61 1e-07 ref|XP_003537895.1| PREDICTED: UPF0496 protein At4g34320-like [G... 61 1e-07 gb|EPS58408.1| hypothetical protein M569_16405 [Genlisea aurea] 61 2e-07 ref|XP_006285511.1| hypothetical protein CARUB_v10006952mg [Caps... 61 2e-07 ref|XP_002519094.1| AT14A, putative [Ricinus communis] gi|223541... 61 2e-07 ref|NP_195158.1| uncharacterized protein [Arabidopsis thaliana] ... 61 2e-07 ref|XP_004985322.1| PREDICTED: UPF0496 protein 1-like [Setaria i... 60 2e-07 ref|XP_004498189.1| PREDICTED: UPF0496 protein At4g34320-like [C... 60 2e-07 >gb|EYU41177.1| hypothetical protein MIMGU_mgv1a008261mg [Mimulus guttatus] Length = 379 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQSRT+N I SLA GVEV+ALSFDSL+EVT CLL+MNQE Sbjct: 48 LQSRTHNVINSLAVGVEVKALSFDSLKEVTECLLEMNQE 86 >ref|XP_004289620.1| PREDICTED: UPF0496 protein At4g34320-like [Fragaria vesca subsp. vesca] Length = 375 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RTN I +LAAGVEVRALSFDSL+EVT CLL+MNQE Sbjct: 50 LQNRTNQVISTLAAGVEVRALSFDSLKEVTECLLEMNQE 88 >gb|EYU37760.1| hypothetical protein MIMGU_mgv1a008357mg [Mimulus guttatus] Length = 376 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ RT+N I SLA GVEVRALSFDSLR+VT CLL+MNQE Sbjct: 49 LQLRTSNVINSLAVGVEVRALSFDSLRQVTECLLEMNQE 87 >ref|XP_007201071.1| hypothetical protein PRUPE_ppa007273mg [Prunus persica] gi|462396471|gb|EMJ02270.1| hypothetical protein PRUPE_ppa007273mg [Prunus persica] Length = 375 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RTN I ++AAGVEVRALSFDSL+E+T CLL+MNQE Sbjct: 50 LQTRTNQVINTIAAGVEVRALSFDSLKEITECLLEMNQE 88 >ref|XP_002313064.1| hypothetical protein POPTR_0009s11550g [Populus trichocarpa] gi|222849472|gb|EEE87019.1| hypothetical protein POPTR_0009s11550g [Populus trichocarpa] Length = 374 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RTN+ I +LA GVEVRALSFDSL+EVT CLL+MNQE Sbjct: 49 LQARTNHVINTLAVGVEVRALSFDSLKEVTECLLEMNQE 87 >ref|XP_006365509.1| PREDICTED: UPF0496 protein At4g34320-like [Solanum tuberosum] Length = 370 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RT++ I SLA GVEVRALSFDSLREVT CLL+MNQE Sbjct: 45 LQARTSHVINSLADGVEVRALSFDSLREVTGCLLEMNQE 83 >ref|XP_002306083.1| hypothetical protein POPTR_0004s15800g [Populus trichocarpa] gi|222849047|gb|EEE86594.1| hypothetical protein POPTR_0004s15800g [Populus trichocarpa] Length = 363 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RTN+ I +LA G+EVRALSFDSL+EVT CLL+MNQE Sbjct: 49 LQARTNHVINTLAVGIEVRALSFDSLKEVTECLLEMNQE 87 >ref|XP_006423198.1| hypothetical protein CICLE_v10030403mg [Citrus clementina] gi|568837234|ref|XP_006472632.1| PREDICTED: UPF0496 protein At4g34320-like [Citrus sinensis] gi|568867745|ref|XP_006487193.1| PREDICTED: UPF0496 protein At4g34320-like [Citrus sinensis] gi|557525132|gb|ESR36438.1| hypothetical protein CICLE_v10030403mg [Citrus clementina] Length = 366 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RT++ I +LAAGVEVRALSFDSL+EVT CLL+MNQE Sbjct: 40 LQARTSHMINTLAAGVEVRALSFDSLKEVTECLLEMNQE 78 >ref|XP_007131859.1| hypothetical protein PHAVU_011G047500g [Phaseolus vulgaris] gi|561004859|gb|ESW03853.1| hypothetical protein PHAVU_011G047500g [Phaseolus vulgaris] Length = 372 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RTN I +LAAGVEVRALSFDSL+++T CL++MNQE Sbjct: 47 LQARTNEVINTLAAGVEVRALSFDSLKQITECLMEMNQE 85 >ref|XP_004230936.1| PREDICTED: UPF0496 protein At4g34320-like isoform 1 [Solanum lycopersicum] gi|460370190|ref|XP_004230937.1| PREDICTED: UPF0496 protein At4g34320-like isoform 2 [Solanum lycopersicum] Length = 370 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RT++ I +LA GVEVRALSFDSLREVT CLL+MNQE Sbjct: 45 LQARTSHVINTLADGVEVRALSFDSLREVTGCLLEMNQE 83 >gb|AFK35357.1| unknown [Medicago truncatula] Length = 371 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RTN I SLA GVEVR+LSFDSL++VT CLL+MNQE Sbjct: 45 LQARTNQVINSLAVGVEVRSLSFDSLKQVTECLLEMNQE 83 >ref|XP_006412240.1| hypothetical protein EUTSA_v100255250mg, partial [Eutrema salsugineum] gi|557113410|gb|ESQ53693.1| hypothetical protein EUTSA_v100255250mg, partial [Eutrema salsugineum] Length = 92 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RT++ I +LA GVEVRALSFDSL+EVT+CLL+MNQE Sbjct: 47 LQARTSHVISTLATGVEVRALSFDSLKEVTACLLEMNQE 85 >ref|XP_004148297.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus] gi|449510317|ref|XP_004163630.1| PREDICTED: UPF0496 protein At4g34320-like [Cucumis sativus] Length = 372 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RT+ AI ++A GVEVRALSFDSL+E+T CLL+MNQE Sbjct: 46 LQARTHQAINTIAVGVEVRALSFDSLKEITECLLEMNQE 84 >ref|XP_003537895.1| PREDICTED: UPF0496 protein At4g34320-like [Glycine max] Length = 374 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RTN I +LA GVEVRALSFDSL+++T CLL+MNQE Sbjct: 47 LQARTNQVINTLAVGVEVRALSFDSLKQITECLLEMNQE 85 >gb|EPS58408.1| hypothetical protein M569_16405 [Genlisea aurea] Length = 406 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ RT+ AI S+AAGVEVR+LS DSLREVT CLL+MNQE Sbjct: 71 LQLRTSRAIHSIAAGVEVRSLSLDSLREVTECLLEMNQE 109 >ref|XP_006285511.1| hypothetical protein CARUB_v10006952mg [Capsella rubella] gi|482554216|gb|EOA18409.1| hypothetical protein CARUB_v10006952mg [Capsella rubella] Length = 376 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RT++ I +LA GVEVRALSFDSL+EVT CLL+MNQE Sbjct: 45 LQARTSHVISTLATGVEVRALSFDSLKEVTQCLLEMNQE 83 >ref|XP_002519094.1| AT14A, putative [Ricinus communis] gi|223541757|gb|EEF43305.1| AT14A, putative [Ricinus communis] Length = 380 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ RTN+ I +LA GVEVR+LSFDSL+EVT CLL+MNQE Sbjct: 49 LQVRTNHVINTLAVGVEVRSLSFDSLKEVTECLLEMNQE 87 >ref|NP_195158.1| uncharacterized protein [Arabidopsis thaliana] gi|75213510|sp|Q9SYZ7.1|U496A_ARATH RecName: Full=UPF0496 protein At4g34320 gi|4455177|emb|CAB36709.1| putative protein [Arabidopsis thaliana] gi|7270382|emb|CAB80149.1| putative protein [Arabidopsis thaliana] gi|332660959|gb|AEE86359.1| uncharacterized protein AT4G34320 [Arabidopsis thaliana] Length = 374 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RT++ I +LA GVEVRALSFDSL+EVT CLL+MNQE Sbjct: 43 LQARTSHVISTLATGVEVRALSFDSLKEVTQCLLEMNQE 81 >ref|XP_004985322.1| PREDICTED: UPF0496 protein 1-like [Setaria italica] Length = 379 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ RT+ AI +LA GVEVR+LS DSLREVT CLLDMNQE Sbjct: 50 LQRRTSRAISTLAVGVEVRSLSLDSLREVTGCLLDMNQE 88 >ref|XP_004498189.1| PREDICTED: UPF0496 protein At4g34320-like [Cicer arietinum] Length = 373 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 205 LQSRTNNAIRSLAAGVEVRALSFDSLREVTSCLLDMNQE 321 LQ+RTN I +LA GVEVR+LSFDSL++VT CLL+MNQE Sbjct: 47 LQARTNQVINTLAVGVEVRSLSFDSLKQVTECLLEMNQE 85