BLASTX nr result
ID: Mentha25_contig00040189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00040189 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX07129.1| calcium-dependent protein kinase 4 [Capsicum annuum] 110 2e-22 gb|EYU18750.1| hypothetical protein MIMGU_mgv1a004372mg [Mimulus... 109 5e-22 ref|XP_006351224.1| PREDICTED: calcium-dependent protein kinase ... 109 5e-22 ref|XP_004249195.1| PREDICTED: calcium-dependent protein kinase ... 109 5e-22 ref|XP_006287466.1| hypothetical protein CARUB_v10000678mg [Caps... 108 8e-22 ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase ... 108 8e-22 emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana pl... 108 8e-22 ref|XP_002873948.1| calcium-dependent protein kinase 19 [Arabido... 108 1e-21 dbj|BAE99123.1| calcium-dependent protein kinase [Arabidopsis th... 108 1e-21 dbj|BAD94111.1| calcium-dependent protein kinase [Arabidopsis th... 108 1e-21 ref|NP_197446.1| calcium-dependent protein kinase 19 [Arabidopsi... 108 1e-21 ref|XP_004228520.1| PREDICTED: calcium-dependent protein kinase ... 107 1e-21 gb|AGG35976.1| calcium-dependent protein kinase 7 [Brassica napus] 107 2e-21 ref|XP_006399766.1| hypothetical protein EUTSA_v10013170mg [Eutr... 107 2e-21 gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium a... 107 2e-21 ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase ... 107 2e-21 ref|XP_006400505.1| hypothetical protein EUTSA_v10013210mg [Eutr... 107 2e-21 ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase ... 106 3e-21 ref|XP_004150764.1| PREDICTED: calcium-dependent protein kinase ... 106 3e-21 gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasilien... 106 3e-21 >gb|AAX07129.1| calcium-dependent protein kinase 4 [Capsicum annuum] Length = 524 Score = 110 bits (276), Expect = 2e-22 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAI+QDVDTDKDGRISY+EF+AMMKAGTDWRKASRQYSRERYNSLSLKLMK+ S Sbjct: 463 SEEVINAIMQDVDTDKDGRISYDEFSAMMKAGTDWRKASRQYSRERYNSLSLKLMKDGS 521 >gb|EYU18750.1| hypothetical protein MIMGU_mgv1a004372mg [Mimulus guttatus] Length = 530 Score = 109 bits (272), Expect = 5e-22 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAIIQDVDTDKDGRIS+EEFAAMMK+GTDWRKASRQYSRERYNSLSLKLM + S Sbjct: 465 SEEVINAIIQDVDTDKDGRISFEEFAAMMKSGTDWRKASRQYSRERYNSLSLKLMTDGS 523 >ref|XP_006351224.1| PREDICTED: calcium-dependent protein kinase 32-like [Solanum tuberosum] Length = 524 Score = 109 bits (272), Expect = 5e-22 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAI+QDVDTDKDGRISY+EF+ MMKAGTDWRKASRQYSRERYNSLSLKLMK+ S Sbjct: 463 SEEVINAIMQDVDTDKDGRISYDEFSTMMKAGTDWRKASRQYSRERYNSLSLKLMKDGS 521 >ref|XP_004249195.1| PREDICTED: calcium-dependent protein kinase 32-like [Solanum lycopersicum] Length = 525 Score = 109 bits (272), Expect = 5e-22 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAI+QDVDTDKDGRISY+EF+ MMKAGTDWRKASRQYSRERYNSLSLKLMK+ S Sbjct: 464 SEEVINAIMQDVDTDKDGRISYDEFSTMMKAGTDWRKASRQYSRERYNSLSLKLMKDGS 522 >ref|XP_006287466.1| hypothetical protein CARUB_v10000678mg [Capsella rubella] gi|482556172|gb|EOA20364.1| hypothetical protein CARUB_v10000678mg [Capsella rubella] Length = 533 Score = 108 bits (270), Expect = 8e-22 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVI AI+QDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM+E S Sbjct: 468 SEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGS 526 >ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum lycopersicum] Length = 533 Score = 108 bits (270), Expect = 8e-22 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAI+ DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM++ S Sbjct: 466 SEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS 524 >emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana plumbaginifolia] Length = 528 Score = 108 bits (270), Expect = 8e-22 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAI+ DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM++ S Sbjct: 463 SEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS 521 >ref|XP_002873948.1| calcium-dependent protein kinase 19 [Arabidopsis lyrata subsp. lyrata] gi|297319785|gb|EFH50207.1| calcium-dependent protein kinase 19 [Arabidopsis lyrata subsp. lyrata] Length = 533 Score = 108 bits (269), Expect = 1e-21 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEV+ AI+QDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM+E S Sbjct: 468 SEEVVAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGS 526 >dbj|BAE99123.1| calcium-dependent protein kinase [Arabidopsis thaliana] Length = 478 Score = 108 bits (269), Expect = 1e-21 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEV+ AI+QDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM+E S Sbjct: 413 SEEVVAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGS 471 >dbj|BAD94111.1| calcium-dependent protein kinase [Arabidopsis thaliana] Length = 97 Score = 108 bits (269), Expect = 1e-21 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEV+ AI+QDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM+E S Sbjct: 32 SEEVVAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGS 90 >ref|NP_197446.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana] gi|30687323|ref|NP_850853.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana] gi|75319668|sp|Q42438.1|CDPK8_ARATH RecName: Full=Calcium-dependent protein kinase 8; AltName: Full=Calcium-dependent protein kinase isoform CDPK19; Short=AtCDPK19 gi|836942|gb|AAA67655.1| calcium-dependent protein kinase [Arabidopsis thaliana] gi|836948|gb|AAA67658.1| calcium-dependent protein kinase [Arabidopsis thaliana] gi|332005325|gb|AED92708.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana] gi|332005326|gb|AED92709.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana] Length = 533 Score = 108 bits (269), Expect = 1e-21 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEV+ AI+QDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM+E S Sbjct: 468 SEEVVAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGS 526 >ref|XP_004228520.1| PREDICTED: calcium-dependent protein kinase 8-like isoform 1 [Solanum lycopersicum] gi|460365259|ref|XP_004228521.1| PREDICTED: calcium-dependent protein kinase 8-like isoform 2 [Solanum lycopersicum] Length = 533 Score = 107 bits (268), Expect = 1e-21 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEV NAI+ DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM+E S Sbjct: 468 SEEVTNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMREGS 526 >gb|AGG35976.1| calcium-dependent protein kinase 7 [Brassica napus] Length = 532 Score = 107 bits (267), Expect = 2e-21 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVI AI+QDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM++ S Sbjct: 467 SEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS 525 >ref|XP_006399766.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|567173219|ref|XP_006399767.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|557100856|gb|ESQ41219.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|557100857|gb|ESQ41220.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] Length = 548 Score = 107 bits (267), Expect = 2e-21 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVI AI+QDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM++ S Sbjct: 483 SEEVIAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS 541 >gb|AFR11232.1| calcium dependent protein kinase 3 [Chenopodium album] Length = 529 Score = 107 bits (267), Expect = 2e-21 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAI++DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+N+LSLKL+K+ S Sbjct: 463 SEEVINAIMRDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNNLSLKLIKDGS 521 >ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum tuberosum] Length = 532 Score = 107 bits (266), Expect = 2e-21 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAI+ DVDTDKDGRISYEEFA MMKAGTDWRKASRQYSRER+NSLSLKLM++ S Sbjct: 465 SEEVINAIMHDVDTDKDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS 523 >ref|XP_006400505.1| hypothetical protein EUTSA_v10013210mg [Eutrema salsugineum] gi|557101595|gb|ESQ41958.1| hypothetical protein EUTSA_v10013210mg [Eutrema salsugineum] Length = 534 Score = 107 bits (266), Expect = 2e-21 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVI AI+QDVDTDKDGRISYEEF AMMKAGTDWRKASRQYSRER+NSLSLKLM+E S Sbjct: 469 SEEVIAAIMQDVDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMREGS 527 >ref|XP_006366539.1| PREDICTED: calcium-dependent protein kinase 8-like [Solanum tuberosum] Length = 533 Score = 106 bits (265), Expect = 3e-21 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEV NAI+ DVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRER+NSLSLKLM++ S Sbjct: 468 SEEVTNAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGS 526 >ref|XP_004150764.1| PREDICTED: calcium-dependent protein kinase 7-like [Cucumis sativus] gi|449508351|ref|XP_004163290.1| PREDICTED: calcium-dependent protein kinase 7-like [Cucumis sativus] Length = 535 Score = 106 bits (265), Expect = 3e-21 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEEVINAII DVDTDKDGRISY+EFAAMMKAGTDWRKASRQYSRER+NSLSL LM++ S Sbjct: 472 SEEVINAIINDVDTDKDGRISYDEFAAMMKAGTDWRKASRQYSRERFNSLSLNLMRDGS 530 >gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis] Length = 530 Score = 106 bits (265), Expect = 3e-21 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -2 Query: 327 SEEVINAIIQDVDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERYNSLSLKLMKEMS 151 SEE+INAII DVDTDKDGRISY+EFA MMKAGTDWRKASRQYSRER+N+LSLKLMK+ S Sbjct: 465 SEEIINAIIHDVDTDKDGRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGS 523