BLASTX nr result
ID: Mentha25_contig00039281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00039281 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41356.1| hypothetical protein MIMGU_mgv1a002000mg [Mimulus... 62 1e-07 >gb|EYU41356.1| hypothetical protein MIMGU_mgv1a002000mg [Mimulus guttatus] Length = 728 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/75 (44%), Positives = 41/75 (54%), Gaps = 1/75 (1%) Frame = -3 Query: 328 HSTFNNQ-SGTVSP*FFPQKQDLGVRSSPMESQKLNPALFREEHHASYYYISHGLSPSIS 152 HS N Q S SP F PQ + +RS +E + + P FREEHH+SYYYI S + Sbjct: 609 HSVLNGQPSAASSPGFSPQDGEFSLRSPAVEKRNIPPGFFREEHHSSYYYI------SAN 662 Query: 151 QYQCNNLPGSCFGTV 107 Q N P SCFG + Sbjct: 663 QQWYGNQPSSCFGAL 677