BLASTX nr result
ID: Mentha25_contig00037301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00037301 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42377.1| hypothetical protein MIMGU_mgv1a022487mg, partial... 59 9e-07 >gb|EYU42377.1| hypothetical protein MIMGU_mgv1a022487mg, partial [Mimulus guttatus] Length = 182 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 3/62 (4%) Frame = -1 Query: 179 SASASETYGGREASLDDSYG--GGPTSTSLWSPENTSSGEDYTKTSGEDRGFV-TQSRSQ 9 +AS S T+GGR+ S + GG TSTS+WSPENTSSG++Y++TS +D + +SRSQ Sbjct: 67 AASESATFGGRDDSFQLTLDTCGGLTSTSMWSPENTSSGKEYSRTSADDHDYSGCRSRSQ 126 Query: 8 RQ 3 + Sbjct: 127 SE 128