BLASTX nr result
ID: Mentha25_contig00036480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00036480 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22373.1| hypothetical protein MIMGU_mgv1a001842mg [Mimulus... 60 4e-07 >gb|EYU22373.1| hypothetical protein MIMGU_mgv1a001842mg [Mimulus guttatus] Length = 751 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/61 (45%), Positives = 39/61 (63%) Frame = -2 Query: 186 AFGSPMYGENWRNANSSYSPAADAAAMPIYLGLLHSGSSGVVRSLASTLDAKGLMDQYAK 7 A GSP Y ENWRN S+YS A D A +P+ LG L ++ L+ +LD++ LM+Q+A Sbjct: 186 ASGSPRYNENWRNPTSAYS-AGDGALIPVGLGFLQHTQGARIQMLSQSLDSQSLMNQFAD 244 Query: 6 W 4 W Sbjct: 245 W 245