BLASTX nr result
ID: Mentha25_contig00036452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00036452 (1085 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34038.1| hypothetical protein MIMGU_mgv1a023941mg [Mimulus... 68 6e-09 ref|XP_002530973.1| phosphatidylinositol n-acetylglucosaminyltra... 59 5e-06 >gb|EYU34038.1| hypothetical protein MIMGU_mgv1a023941mg [Mimulus guttatus] Length = 526 Score = 68.2 bits (165), Expect = 6e-09 Identities = 33/58 (56%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = +2 Query: 917 KRTNQHSPDSVLESFDIKSS--YECFDSTGLLLQLESLNFESGETYSEGSVMVISGDE 1084 ++T+QHSPDSVLE DI++S +E FD GL +QL++LN ES ETYSEGS+M +S ++ Sbjct: 304 EKTSQHSPDSVLEPCDIQNSSNFEYFDRIGLQMQLQALNIESEETYSEGSIMAVSDED 361 >ref|XP_002530973.1| phosphatidylinositol n-acetylglucosaminyltransferase subunit p, putative [Ricinus communis] gi|223529449|gb|EEF31408.1| phosphatidylinositol n-acetylglucosaminyltransferase subunit p, putative [Ricinus communis] Length = 848 Score = 58.5 bits (140), Expect = 5e-06 Identities = 39/89 (43%), Positives = 49/89 (55%), Gaps = 8/89 (8%) Frame = +2 Query: 842 NEYFEEESAYSNFSAIVPPESLKNLKRTNQHSPDSVLESF---DIKSSYECFDST----- 997 NE FEEES S +S PESL + + Q SP+SVLE +I CF+ Sbjct: 582 NEMFEEESISSQYSG-TDPESLMSAEEAYQPSPNSVLEPIYMKEISPVSNCFEGVNTSLH 640 Query: 998 GLLLQLESLNFESGETYSEGSVMVISGDE 1084 GL +QLE L E E+YSE S M++S DE Sbjct: 641 GLQMQLELLKSEGLESYSEASSMMVSSDE 669