BLASTX nr result
ID: Mentha25_contig00036279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00036279 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37431.1| hypothetical protein MIMGU_mgv1a008545mg [Mimulus... 61 1e-08 >gb|EYU37431.1| hypothetical protein MIMGU_mgv1a008545mg [Mimulus guttatus] Length = 370 Score = 60.8 bits (146), Expect(2) = 1e-08 Identities = 35/68 (51%), Positives = 40/68 (58%) Frame = +3 Query: 99 ICLNSSQNPASEQLPLSMPFINSLPLNPSQPFQNSTFINSKGNTQSFPLAYQNAGSIETQ 278 I L ++Q + E P SM F L S PF ST +NS G T F L YQNA SIE Q Sbjct: 85 IILTATQTLSFE--PPSMSFTGPLSSKSSLPFHQSTLVNSNGLTMPFALTYQNASSIEAQ 142 Query: 279 VVNKVVPN 302 VVNKVVP+ Sbjct: 143 VVNKVVPD 150 Score = 23.9 bits (50), Expect(2) = 1e-08 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 7 IPYRIKHLQPWR 42 IP RI+H QPW+ Sbjct: 68 IPCRIRHRQPWQ 79