BLASTX nr result
ID: Mentha25_contig00035999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035999 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35582.1| hypothetical protein MIMGU_mgv1a000247mg [Mimulus... 56 5e-06 >gb|EYU35582.1| hypothetical protein MIMGU_mgv1a000247mg [Mimulus guttatus] Length = 1370 Score = 56.2 bits (134), Expect = 5e-06 Identities = 34/59 (57%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -2 Query: 176 PVPSTSQPLAYHPPPLHHEIGGTPSGDRPVHVGSSMQGSHTDAP-RGEMYSQHSSFFSP 3 P STSQPLA HPPPL HEIGG+ S ++ VH+ SS DAP R E++ Q SFFSP Sbjct: 1137 PEVSTSQPLA-HPPPLPHEIGGSHSVNQHVHMVSSTHVPRMDAPVRSEVFPQ-QSFFSP 1193