BLASTX nr result
ID: Mentha25_contig00035818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035818 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219107.1| hypothetical protein PRUPE_ppa015606mg [Prun... 56 6e-06 ref|XP_007211663.1| hypothetical protein PRUPE_ppa009006mg [Prun... 55 8e-06 ref|XP_003532138.1| PREDICTED: cell differentiation protein RCD1... 55 8e-06 >ref|XP_007219107.1| hypothetical protein PRUPE_ppa015606mg [Prunus persica] gi|462415569|gb|EMJ20306.1| hypothetical protein PRUPE_ppa015606mg [Prunus persica] Length = 221 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = -2 Query: 378 LLEDPTTRRWLQQLLHNVQSTRV-TMQAGGGFD-LMVN 271 L EDPTTRRWLQQLLHNV +RV +QAGGGFD +MVN Sbjct: 184 LREDPTTRRWLQQLLHNVSVSRVPALQAGGGFDHMMVN 221 >ref|XP_007211663.1| hypothetical protein PRUPE_ppa009006mg [Prunus persica] gi|462407528|gb|EMJ12862.1| hypothetical protein PRUPE_ppa009006mg [Prunus persica] Length = 310 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = -2 Query: 378 LLEDPTTRRWLQQLLHNVQSTRV-TMQAGGGFD-LMVN 271 L EDPTTRRWLQQLLHNV +RV +QAGGGFD +MVN Sbjct: 273 LREDPTTRRWLQQLLHNVAVSRVPALQAGGGFDHMMVN 310 >ref|XP_003532138.1| PREDICTED: cell differentiation protein RCD1 homolog [Glycine max] Length = 325 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -2 Query: 378 LLEDPTTRRWLQQLLHNVQSTRV-TMQAGGGFDLMV 274 L EDPTTRRWLQQLLHNV RV +QAGGGFD M+ Sbjct: 288 LREDPTTRRWLQQLLHNVGGNRVPALQAGGGFDHMI 323