BLASTX nr result
ID: Mentha25_contig00035531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035531 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERF69729.1| hypothetical protein EPUS_09349 [Endocarpon pusil... 56 6e-06 >gb|ERF69729.1| hypothetical protein EPUS_09349 [Endocarpon pusillum Z07020] Length = 749 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/42 (57%), Positives = 36/42 (85%) Frame = -3 Query: 452 LTTKLRHIDILQHWLREKIKNLRYLMELSWIPTSQMPADGLT 327 L +KLRH+DI +HWLR++I++ + ++L WIPT++MPADGLT Sbjct: 656 LDSKLRHVDIHRHWLRQEIQSGK--IDLEWIPTAEMPADGLT 695