BLASTX nr result
ID: Mentha25_contig00035509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035509 (761 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ67108.1| general transcription factor [Blumeria graminis f... 98 3e-18 emb|CCU81921.1| transcription initiation factor TFIID/TATA-box-b... 96 1e-17 gb|ELR08458.1| TATA-box-binding protein [Pseudogymnoascus destru... 85 3e-14 ref|XP_007293775.1| transcription initiation factor TFIID-2 [Mar... 81 5e-13 gb|EHL03148.1| putative TATA-box-binding protein [Glarea lozoyen... 80 1e-12 gb|ESZ91651.1| TATA binding protein [Sclerotinia borealis F-4157] 76 1e-11 gb|ETN41441.1| TATA-box-binding protein [Cyphellophora europaea ... 74 4e-11 ref|XP_001558505.1| transcription initiation factor TFIID, TATA ... 74 4e-11 gb|EJT81679.1| TATA-box-binding protein [Gaeumannomyces graminis... 73 1e-10 gb|ACB30147.1| TATA binding protein [Epichloe festucae] 73 1e-10 ref|XP_003713902.1| TATA-box-binding protein [Magnaporthe oryzae... 72 2e-10 gb|EKV05837.1| RNA polymerase I and III transcription factor com... 72 2e-10 ref|XP_002143637.1| RNA polymerase I and III transcription facto... 72 2e-10 gb|EQL37384.1| TATA-box-binding protein [Ajellomyces dermatitidi... 72 3e-10 gb|EMR61396.1| putative tata-box-binding protein [Eutypa lata UC... 72 3e-10 gb|EOO03700.1| putative tata-box-binding protein [Togninia minim... 71 4e-10 emb|CCE29679.1| probable transcription initiation factor TFIID [... 71 4e-10 ref|XP_002479956.1| RNA polymerase I and III transcription facto... 71 4e-10 gb|EKG20002.1| TATA-box binding protein [Macrophomina phaseolina... 71 5e-10 ref|XP_003052617.1| predicted protein [Nectria haematococca mpVI... 71 5e-10 >gb|EPQ67108.1| general transcription factor [Blumeria graminis f. sp. tritici 96224] Length = 261 Score = 98.2 bits (243), Expect = 3e-18 Identities = 55/88 (62%), Positives = 64/88 (72%), Gaps = 5/88 (5%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLT-HSQEIEKQRLSQSNDNQQLSNLTSNK 75 MEQIQTHPSNAAQAKTFIAPGSLSFP GA DLT S +IEKQ+++Q+N+ Q T+ Sbjct: 1 MEQIQTHPSNAAQAKTFIAPGSLSFPGGAGDLTPPSTDIEKQKVAQANNAHQAVVGTTGN 60 Query: 74 TVNP----AAPSASQTVTTGVSGIVPTL 3 + P A P+AS T GVSGIVPTL Sbjct: 61 GITPATPAATPNASHGATIGVSGIVPTL 88 >emb|CCU81921.1| transcription initiation factor TFIID/TATA-box-binding protein [Blumeria graminis f. sp. hordei DH14] Length = 261 Score = 95.9 bits (237), Expect = 1e-17 Identities = 57/88 (64%), Positives = 67/88 (76%), Gaps = 5/88 (5%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLT-HSQEIEKQRLSQSND-NQQLSNLTSN 78 MEQIQTHPSNAAQAKTFIAPGSLSFP GA DLT S +I+KQ+++Q N+ +Q ++ T N Sbjct: 1 MEQIQTHPSNAAQAKTFIAPGSLSFPGGAGDLTPPSTDIDKQKVAQVNNVHQAVAGPTGN 60 Query: 77 KT--VNPAA-PSASQTVTTGVSGIVPTL 3 T PAA P+AS T GVSGIVPTL Sbjct: 61 GTTPATPAATPNASHGATIGVSGIVPTL 88 >gb|ELR08458.1| TATA-box-binding protein [Pseudogymnoascus destructans 20631-21] Length = 262 Score = 84.7 bits (208), Expect = 3e-14 Identities = 51/89 (57%), Positives = 57/89 (64%), Gaps = 6/89 (6%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLT-HSQEIEK---QRLSQSNDNQ--QLSN 90 M IQTHP NA QAKTFIAPGSLSFP GA DLT S E EK Q+ +N Q Q + Sbjct: 1 MNSIQTHPENAMQAKTFIAPGSLSFPGGAGDLTPPSSEAEKMNGQQKQGANGGQAVQANG 60 Query: 89 LTSNKTVNPAAPSASQTVTTGVSGIVPTL 3 T+ V PA P+A+ T GVSGIVPTL Sbjct: 61 QTNGHGVTPATPAATPGATQGVSGIVPTL 89 >ref|XP_007293775.1| transcription initiation factor TFIID-2 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862826|gb|EKD15875.1| transcription initiation factor TFIID-2 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 264 Score = 80.9 bits (198), Expect = 5e-13 Identities = 52/91 (57%), Positives = 56/91 (61%), Gaps = 8/91 (8%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLT-HSQEIEK---QRLSQSNDNQQLSNLT 84 M+ IQTHP+NAA AK FIAPGSLSFP GA +LT S E EK QR Q N QQ Sbjct: 1 MDPIQTHPANAAHAKAFIAPGSLSFPGGAGELTPPSSEAEKRNGQRPGQMNGGQQQVGQP 60 Query: 83 SN-KTVNPAAP---SASQTVTTGVSGIVPTL 3 N V PA P A+ TTGVSGIVPTL Sbjct: 61 QNGNGVTPATPVATPAAAAATTGVSGIVPTL 91 >gb|EHL03148.1| putative TATA-box-binding protein [Glarea lozoyensis 74030] gi|512200127|gb|EPE28959.1| TATA-box binding protein-like protein [Glarea lozoyensis ATCC 20868] Length = 255 Score = 79.7 bits (195), Expect = 1e-12 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 2/85 (2%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 M+QI THPSNAAQAKTFIAPGSLSFP GA +LT + + ++ N QQ++ Sbjct: 1 MDQITTHPSNAAQAKTFIAPGSLSFPGGAHELTPPTDGQTAKM---NGQQQVAQGHVGNG 57 Query: 71 VNPAAPSAS--QTVTTGVSGIVPTL 3 V PA P+A+ + TGVSGIVPTL Sbjct: 58 VAPATPAATPGTSAPTGVSGIVPTL 82 >gb|ESZ91651.1| TATA binding protein [Sclerotinia borealis F-4157] Length = 250 Score = 76.3 bits (186), Expect = 1e-11 Identities = 42/83 (50%), Positives = 51/83 (61%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 ME IQTHPS+A +AK FIAPGSLSFP GAAD+T E + +Q ++ T Sbjct: 1 MESIQTHPSSAVEAKKFIAPGSLSFPGGAADVTPPSNTE------AAAGKQTMSVAPVTT 54 Query: 71 VNPAAPSASQTVTTGVSGIVPTL 3 PA P+ + T GVSGIVPTL Sbjct: 55 SPPATPATTPAATQGVSGIVPTL 77 >gb|ETN41441.1| TATA-box-binding protein [Cyphellophora europaea CBS 101466] Length = 256 Score = 74.3 bits (181), Expect = 4e-11 Identities = 38/83 (45%), Positives = 47/83 (56%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 M+ + THP+NA QAK F +P SLSFP GA DLT E + Q + QQ + Sbjct: 1 MDSLTTHPANAQQAKAFTSPASLSFPGGAGDLTPPSEKDGQNQDAKMNGQQQGSSQQGNG 60 Query: 71 VNPAAPSASQTVTTGVSGIVPTL 3 V PA P+A+ G SGIVPTL Sbjct: 61 VTPATPAATPGAGPGTSGIVPTL 83 >ref|XP_001558505.1| transcription initiation factor TFIID, TATA binding protein [Botryotinia fuckeliana B05.10] gi|347837614|emb|CCD52186.1| similar to transcription initiation factor TFIID [Botryotinia fuckeliana T4] gi|472244396|gb|EMR89013.1| putative rna polymerase i and iii transcription factor complex component protein [Botryotinia fuckeliana BcDW1] Length = 251 Score = 74.3 bits (181), Expect = 4e-11 Identities = 42/83 (50%), Positives = 49/83 (59%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 M+ IQTHPS+A AK FIAPGSLSFP GAAD+T E QQ++ Sbjct: 1 MDSIQTHPSSAVDAKNFIAPGSLSFPGGAADITPPSTNEAVA-----GKQQVTPAAPVAA 55 Query: 71 VNPAAPSASQTVTTGVSGIVPTL 3 PA P+A+ T GVSGIVPTL Sbjct: 56 SPPATPAATPAATQGVSGIVPTL 78 >gb|EJT81679.1| TATA-box-binding protein [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 255 Score = 73.2 bits (178), Expect = 1e-10 Identities = 41/83 (49%), Positives = 49/83 (59%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 ME IQTHPSNAAQAK F APGSLSFP G +LT ++ QR N Q + + Sbjct: 1 MEGIQTHPSNAAQAKAFTAPGSLSFPGGHGELTPPNDVNGQR-PVVNGVQPGAQAVNGTG 59 Query: 71 VNPAAPSASQTVTTGVSGIVPTL 3 V PA P+A+ T SG+ PTL Sbjct: 60 VTPATPAATPAATQTGSGLTPTL 82 >gb|ACB30147.1| TATA binding protein [Epichloe festucae] Length = 256 Score = 73.2 bits (178), Expect = 1e-10 Identities = 40/83 (48%), Positives = 47/83 (56%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 ME IQTHPSNAAQAK F APGSLSFP +LT + + QQ +N Sbjct: 1 MESIQTHPSNAAQAKAFTAPGSLSFPGATNELTPPASGGDSLQRPAVNGQQAANGNGVTP 60 Query: 71 VNPAAPSASQTVTTGVSGIVPTL 3 PA P+A+ + T G SGI PTL Sbjct: 61 ATPATPAATPSATQGPSGITPTL 83 >ref|XP_003713902.1| TATA-box-binding protein [Magnaporthe oryzae 70-15] gi|351646235|gb|EHA54095.1| TATA-box-binding protein [Magnaporthe oryzae 70-15] gi|440473248|gb|ELQ42063.1| TATA-box-binding protein [Magnaporthe oryzae Y34] gi|440480212|gb|ELQ60887.1| TATA-box-binding protein [Magnaporthe oryzae P131] Length = 255 Score = 72.4 bits (176), Expect = 2e-10 Identities = 42/84 (50%), Positives = 51/84 (60%), Gaps = 1/84 (1%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 ME IQTHPSNAAQAK F APGSLSFP G +LT + QR + + L + +N T Sbjct: 1 MEGIQTHPSNAAQAKAFTAPGSLSFPGGHGELTPPNDANGQR--PAANGAPLGSQAANGT 58 Query: 71 -VNPAAPSASQTVTTGVSGIVPTL 3 V PA P+A+ T SG+ PTL Sbjct: 59 GVTPATPAATPAATQTGSGLTPTL 82 >gb|EKV05837.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Penicillium digitatum PHI26] gi|425780061|gb|EKV18083.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Penicillium digitatum Pd1] Length = 263 Score = 72.0 bits (175), Expect = 2e-10 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 8/91 (8%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQS----NDNQQLSNLT 84 M+ + THPSNA QA+ F A SLSFP GA DLT EK+ ++Q N+ QQ Sbjct: 1 MDSLTTHPSNAQQARAFTATSSLSFPGGAGDLTPPNS-EKEAMAQGGNGMNNGQQAGGNA 59 Query: 83 SNKT----VNPAAPSASQTVTTGVSGIVPTL 3 N T +PA P+A+ TTG SGIVPTL Sbjct: 60 MNGTGVTPASPATPAATPGATTGSSGIVPTL 90 >ref|XP_002143637.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|212526962|ref|XP_002143638.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|212526964|ref|XP_002143639.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|62956011|gb|AAY23352.1| TATA-binding protein [Talaromyces marneffei] gi|62956013|gb|AAY23353.1| TATA-binding protein [Talaromyces marneffei] gi|210073035|gb|EEA27122.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|210073036|gb|EEA27123.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] gi|210073037|gb|EEA27124.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces marneffei ATCC 18224] Length = 255 Score = 72.0 bits (175), Expect = 2e-10 Identities = 40/83 (48%), Positives = 49/83 (59%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 M+ + THPSNA QAK F +P SLSFP GA DLT ++ L+ N QQ +N N Sbjct: 1 MDSLTTHPSNAQQAKAFTSPASLSFPGGAGDLTPPSSEKEGNLAGLNGQQQGANANGN-G 59 Query: 71 VNPAAPSASQTVTTGVSGIVPTL 3 V PA P+A+ SGIVPTL Sbjct: 60 VTPATPAATPGANNVGSGIVPTL 82 >gb|EQL37384.1| TATA-box-binding protein [Ajellomyces dermatitidis ATCC 26199] gi|531986798|gb|EQL37385.1| TATA-box-binding protein, variant [Ajellomyces dermatitidis ATCC 26199] Length = 262 Score = 71.6 bits (174), Expect = 3e-10 Identities = 44/89 (49%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLT-HSQEIE---KQRLSQSNDNQQLSNLT 84 M+ + THPS A QAK F +P SLSFP GA DLT S E E + L Q+N Q N T Sbjct: 1 MDSLTTHPSTAEQAKAFTSPASLSFPGGAGDLTPPSSEKEPGPEHGLQQANGQLQAGNAT 60 Query: 83 SNKTVNPAAPSASQTVTT--GVSGIVPTL 3 + V PA P+A+ GVSGIVPTL Sbjct: 61 TGNGVTPATPAATPGAGAGPGVSGIVPTL 89 >gb|EMR61396.1| putative tata-box-binding protein [Eutypa lata UCREL1] Length = 260 Score = 71.6 bits (174), Expect = 3e-10 Identities = 38/87 (43%), Positives = 50/87 (57%), Gaps = 4/87 (4%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADL----THSQEIEKQRLSQSNDNQQLSNLT 84 M+ IQTHP+ AAQAK F APGSLSFP GA + T +++ Q+ + QQ Sbjct: 1 MDGIQTHPATAAQAKAFTAPGSLSFPGGAGEFTPPPTEAEKANGQQRYVNGGGQQSGQAA 60 Query: 83 SNKTVNPAAPSASQTVTTGVSGIVPTL 3 + V PA P+A+ T G SG+ PTL Sbjct: 61 NGTGVTPATPAATPAATQGGSGLTPTL 87 >gb|EOO03700.1| putative tata-box-binding protein [Togninia minima UCRPA7] Length = 260 Score = 71.2 bits (173), Expect = 4e-10 Identities = 45/90 (50%), Positives = 54/90 (60%), Gaps = 7/90 (7%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLT-HSQEIEKQRLSQSNDN-----QQLSN 90 M+QIQTHPS AAQAK F APGSLSFP G +LT S ++K + +S N Q N Sbjct: 1 MDQIQTHPSTAAQAKAFTAPGSLSFPGGHGELTPPSDSLDKMNMGRSGVNGGPAGPQAPN 60 Query: 89 LTSNKTVNPAAPSASQTVTT-GVSGIVPTL 3 T V PA P+A+ TT G SG+ PTL Sbjct: 61 GTG---VTPATPAATPAATTQGGSGLTPTL 87 >emb|CCE29679.1| probable transcription initiation factor TFIID [Claviceps purpurea 20.1] Length = 253 Score = 71.2 bits (173), Expect = 4e-10 Identities = 43/84 (51%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLT-HSQEIEKQRLSQSNDNQQLSNLTSNK 75 ME IQTHPSNAAQAK F APGSLSFP +LT S E + +N +Q S Sbjct: 1 MEGIQTHPSNAAQAKAFTAPGSLSFPGATNELTPPSTNGESTQRPVANGSQ----TASGN 56 Query: 74 TVNPAAPSASQTVTTGVSGIVPTL 3 V PA P+A+ T G SGI PTL Sbjct: 57 GVTPATPAATPNATQGPSGITPTL 80 >ref|XP_002479956.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|242782222|ref|XP_002479957.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|218720103|gb|EED19522.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] gi|218720104|gb|EED19523.1| RNA polymerase I and III transcription factor complex component Tbp, putative [Talaromyces stipitatus ATCC 10500] Length = 255 Score = 71.2 bits (173), Expect = 4e-10 Identities = 40/83 (48%), Positives = 48/83 (57%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 M+ + THPSNA QAK F +P SLSFP GA DLT ++ L N QQ +N N Sbjct: 1 MDSLTTHPSNAQQAKAFTSPASLSFPGGAGDLTPPSSEKEGNLVGMNGQQQGANANGN-G 59 Query: 71 VNPAAPSASQTVTTGVSGIVPTL 3 V PA P+A+ SGIVPTL Sbjct: 60 VTPATPAATPGANNVGSGIVPTL 82 >gb|EKG20002.1| TATA-box binding protein [Macrophomina phaseolina MS6] Length = 250 Score = 70.9 bits (172), Expect = 5e-10 Identities = 41/84 (48%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 M+ + THPSNA QAK F APGSLSFP GA DLT + + SQ+ N + Sbjct: 1 MDSLTTHPSNATQAKAFTAPGSLSFPGGAGDLTPPSSEKDVQQSQNGGN-------AGNG 53 Query: 71 VNPAAPSASQ-TVTTGVSGIVPTL 3 V PA P+A+ GVSGIVPTL Sbjct: 54 VMPATPAATPGAAANGVSGIVPTL 77 >ref|XP_003052617.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256733557|gb|EEU46904.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 253 Score = 70.9 bits (172), Expect = 5e-10 Identities = 41/83 (49%), Positives = 47/83 (56%) Frame = -1 Query: 251 MEQIQTHPSNAAQAKTFIAPGSLSFPNGAADLTHSQEIEKQRLSQSNDNQQLSNLTSNKT 72 ME IQTHPSNAAQAK F APGSLSFP +LT + + QQ +N Sbjct: 1 MEGIQTHPSNAAQAKAFTAPGSLSFPGATNELTPPAGNGNAAQLPAPNGQQAAN---GNG 57 Query: 71 VNPAAPSASQTVTTGVSGIVPTL 3 V PA P+A+ T G SGI PTL Sbjct: 58 VTPATPAATPAATQGPSGITPTL 80