BLASTX nr result
ID: Mentha25_contig00035488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035488 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23109.1| hypothetical protein MIMGU_mgv1a007540mg [Mimulus... 92 1e-16 ref|XP_006352262.1| PREDICTED: WD repeat-containing protein 74-l... 75 1e-11 gb|EPS73907.1| hypothetical protein M569_00848, partial [Genlise... 75 1e-11 ref|XP_002511220.1| WD-repeat protein, putative [Ricinus communi... 74 3e-11 ref|XP_004244621.1| PREDICTED: WD repeat-containing protein 74-l... 73 4e-11 ref|XP_002321685.1| transducin family protein [Populus trichocar... 72 1e-10 ref|XP_002318118.1| transducin family protein [Populus trichocar... 72 1e-10 ref|XP_004957801.1| PREDICTED: WD repeat-containing protein 74-l... 71 1e-10 ref|XP_004957800.1| PREDICTED: WD repeat-containing protein 74-l... 71 1e-10 tpg|DAA62840.1| TPA: hypothetical protein ZEAMMB73_316659 [Zea m... 71 1e-10 tpg|DAA40932.1| TPA: hypothetical protein ZEAMMB73_321334 [Zea m... 71 1e-10 ref|XP_002462906.1| hypothetical protein SORBIDRAFT_02g034230 [S... 71 1e-10 ref|NP_001140808.1| uncharacterized protein LOC100272883 [Zea ma... 71 1e-10 ref|XP_006658595.1| PREDICTED: WD repeat-containing protein DDB_... 70 2e-10 gb|ADN33953.1| WD-repeat protein [Cucumis melo subsp. melo] 70 2e-10 ref|XP_002277288.1| PREDICTED: WD repeat-containing protein 74 [... 70 2e-10 gb|EXC51645.1| WD repeat-containing protein 74 [Morus notabilis] 70 3e-10 gb|EEE67235.1| hypothetical protein OsJ_24378 [Oryza sativa Japo... 69 5e-10 ref|XP_007222926.1| hypothetical protein PRUPE_ppa005213mg [Prun... 68 2e-09 ref|XP_006440066.1| hypothetical protein CICLE_v10020238mg [Citr... 67 2e-09 >gb|EYU23109.1| hypothetical protein MIMGU_mgv1a007540mg [Mimulus guttatus] Length = 404 Score = 91.7 bits (226), Expect = 1e-16 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSEAPAAPQVVNTAEEDDQEASP 242 CGLDSYLRIWDIQSRQLLSAVFLKQHLT+VVFDSHFR E P P+V NT EE + +P Sbjct: 316 CGLDSYLRIWDIQSRQLLSAVFLKQHLTSVVFDSHFRKEVP-VPEVTNTVEEAEVIETP 373 >ref|XP_006352262.1| PREDICTED: WD repeat-containing protein 74-like [Solanum tuberosum] Length = 416 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/63 (61%), Positives = 47/63 (74%), Gaps = 7/63 (11%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRS-EAPAAPQ------VVNTAEED 260 CGLDSYLRIWD++SRQLLSAVFLKQHL +VVFDS F + EA PQ + T EE+ Sbjct: 320 CGLDSYLRIWDVKSRQLLSAVFLKQHLNSVVFDSKFSTREAQVPPQQQDTDETLQTEEEE 379 Query: 259 DQE 251 ++E Sbjct: 380 EEE 382 >gb|EPS73907.1| hypothetical protein M569_00848, partial [Genlisea aurea] Length = 359 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/39 (82%), Positives = 39/39 (100%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSE 302 CGLDSYLRIWD+Q+RQLL+AVFLKQHLT+VVFD+HF+S+ Sbjct: 320 CGLDSYLRIWDVQNRQLLAAVFLKQHLTSVVFDTHFKSK 358 >ref|XP_002511220.1| WD-repeat protein, putative [Ricinus communis] gi|223550335|gb|EEF51822.1| WD-repeat protein, putative [Ricinus communis] Length = 406 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/59 (62%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHF-RSEAPAAPQVVNTAEEDDQEAS 245 CGLDSYLR+WDI++RQLLSAVFLKQHLTNVVFDS F E Q N + +D+ S Sbjct: 317 CGLDSYLRLWDIKTRQLLSAVFLKQHLTNVVFDSSFSEREVEVESQNSNVIQHEDEIGS 375 >ref|XP_004244621.1| PREDICTED: WD repeat-containing protein 74-like [Solanum lycopersicum] Length = 415 Score = 73.2 bits (178), Expect = 4e-11 Identities = 39/61 (63%), Positives = 47/61 (77%), Gaps = 5/61 (8%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRS-EAPAAPQVVNTAE----EDDQ 254 CGLDSYLRIWD++SRQLLSAVFLKQHL +VVFDS F + EA PQ +T E E+++ Sbjct: 320 CGLDSYLRIWDVKSRQLLSAVFLKQHLNSVVFDSKFSTREAQVPPQQHDTDETLQTEEEE 379 Query: 253 E 251 E Sbjct: 380 E 380 >ref|XP_002321685.1| transducin family protein [Populus trichocarpa] gi|222868681|gb|EEF05812.1| transducin family protein [Populus trichocarpa] Length = 365 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHF 311 CGLDSYLR+WDI++RQLLSAVFLKQHLTNVVFDS+F Sbjct: 316 CGLDSYLRLWDIKTRQLLSAVFLKQHLTNVVFDSNF 351 >ref|XP_002318118.1| transducin family protein [Populus trichocarpa] gi|222858791|gb|EEE96338.1| transducin family protein [Populus trichocarpa] Length = 355 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHF 311 CGLDSYLR+WDI++RQLLSAVFLKQHLTNVVFDS+F Sbjct: 306 CGLDSYLRLWDIKTRQLLSAVFLKQHLTNVVFDSNF 341 >ref|XP_004957801.1| PREDICTED: WD repeat-containing protein 74-like isoform X2 [Setaria italica] Length = 476 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSEAP 296 CGLDSYLRIWD +RQLLSAVFLKQHLT VV DSHF E P Sbjct: 319 CGLDSYLRIWDTNTRQLLSAVFLKQHLTTVVIDSHFSVEEP 359 >ref|XP_004957800.1| PREDICTED: WD repeat-containing protein 74-like isoform X1 [Setaria italica] Length = 525 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSEAP 296 CGLDSYLRIWD +RQLLSAVFLKQHLT VV DSHF E P Sbjct: 319 CGLDSYLRIWDTNTRQLLSAVFLKQHLTTVVIDSHFSVEEP 359 >tpg|DAA62840.1| TPA: hypothetical protein ZEAMMB73_316659 [Zea mays] Length = 475 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSEAP 296 CGLDSYLRIWD +RQLLSAVFLKQHLT VV DSHF E P Sbjct: 319 CGLDSYLRIWDTNTRQLLSAVFLKQHLTTVVLDSHFSVEEP 359 >tpg|DAA40932.1| TPA: hypothetical protein ZEAMMB73_321334 [Zea mays] Length = 461 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSEAP 296 CGLDSYLRIWD +RQLLSAVFLKQHLT VV DSHF E P Sbjct: 319 CGLDSYLRIWDTNTRQLLSAVFLKQHLTTVVLDSHFSVEEP 359 >ref|XP_002462906.1| hypothetical protein SORBIDRAFT_02g034230 [Sorghum bicolor] gi|241926283|gb|EER99427.1| hypothetical protein SORBIDRAFT_02g034230 [Sorghum bicolor] Length = 478 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSEAP 296 CGLDSYLRIWD +RQLLSAVFLKQHLT VV DSHF E P Sbjct: 319 CGLDSYLRIWDTNTRQLLSAVFLKQHLTTVVLDSHFSLEEP 359 >ref|NP_001140808.1| uncharacterized protein LOC100272883 [Zea mays] gi|194701188|gb|ACF84678.1| unknown [Zea mays] gi|238011026|gb|ACR36548.1| unknown [Zea mays] Length = 475 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSEAP 296 CGLDSYLRIWD +RQLLSAVFLKQHLT VV DSHF E P Sbjct: 319 CGLDSYLRIWDTNTRQLLSAVFLKQHLTTVVLDSHFSVEEP 359 >ref|XP_006658595.1| PREDICTED: WD repeat-containing protein DDB_G0290555-like [Oryza brachyantha] Length = 549 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSE 302 CGLDSYLRIWD +RQLLSAVFLKQHLT+VV DSHF +E Sbjct: 438 CGLDSYLRIWDTDTRQLLSAVFLKQHLTSVVIDSHFSTE 476 >gb|ADN33953.1| WD-repeat protein [Cucumis melo subsp. melo] Length = 422 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSE 302 CGLDSY+R WDI +RQLLSAVFLKQHLT VVFDSHF E Sbjct: 320 CGLDSYVRFWDINTRQLLSAVFLKQHLTGVVFDSHFVGE 358 >ref|XP_002277288.1| PREDICTED: WD repeat-containing protein 74 [Vitis vinifera] gi|297742065|emb|CBI33852.3| unnamed protein product [Vitis vinifera] Length = 421 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 8/64 (12%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSE--------APAAPQVVNTAEE 263 CGLDSYLR WDI++R++LSAVFLKQ LTNVVFDS+F E P Q N +E Sbjct: 320 CGLDSYLRFWDIKTRKVLSAVFLKQPLTNVVFDSNFAEEEVPSSVVDPPTEAQNTNETQE 379 Query: 262 DDQE 251 D+E Sbjct: 380 SDEE 383 >gb|EXC51645.1| WD repeat-containing protein 74 [Morus notabilis] Length = 459 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSE 302 CGLDSYLR+WD+++RQLLSAVFLKQHL VVFDS+F SE Sbjct: 338 CGLDSYLRLWDVKTRQLLSAVFLKQHLVRVVFDSNFTSE 376 >gb|EEE67235.1| hypothetical protein OsJ_24378 [Oryza sativa Japonica Group] Length = 466 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSE 302 CGLDSYLRIWD +RQLLSAVFLKQHLT VV DSHF +E Sbjct: 355 CGLDSYLRIWDTNTRQLLSAVFLKQHLTAVVIDSHFSTE 393 >ref|XP_007222926.1| hypothetical protein PRUPE_ppa005213mg [Prunus persica] gi|462419862|gb|EMJ24125.1| hypothetical protein PRUPE_ppa005213mg [Prunus persica] Length = 472 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 5/64 (7%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSEA-----PAAPQVVNTAEEDDQ 254 CGLDSYLR+W++++RQLLSAV LKQHLTNV+FDS+F E AA ++ E D+ Sbjct: 321 CGLDSYLRLWNVKTRQLLSAVHLKQHLTNVLFDSNFADEEAEIAHSAADWPLHEDERDEG 380 Query: 253 EASP 242 + P Sbjct: 381 KTPP 384 >ref|XP_006440066.1| hypothetical protein CICLE_v10020238mg [Citrus clementina] gi|557542328|gb|ESR53306.1| hypothetical protein CICLE_v10020238mg [Citrus clementina] Length = 430 Score = 67.4 bits (163), Expect = 2e-09 Identities = 39/68 (57%), Positives = 43/68 (63%), Gaps = 9/68 (13%) Frame = -1 Query: 418 CGLDSYLRIWDIQSRQLLSAVFLKQHLTNVVFDSHFRSE-----APAAP----QVVNTAE 266 CGLDSYLR WDI++RQLLSAVFLKQHL VVFDS F + A AP Q N + Sbjct: 319 CGLDSYLRFWDIKTRQLLSAVFLKQHLNEVVFDSAFADKEVANAAADAPMLEIQNGNDTQ 378 Query: 265 EDDQEASP 242 ED E P Sbjct: 379 EDATETLP 386