BLASTX nr result
ID: Mentha25_contig00035274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035274 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29081.1| hypothetical protein MIMGU_mgv1a004898mg [Mimulus... 57 3e-06 >gb|EYU29081.1| hypothetical protein MIMGU_mgv1a004898mg [Mimulus guttatus] Length = 505 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 40 VKKSDISRGIEGLMGDGGIRDRAMALRGVFKAGYPSSSAAS 162 VKK DI GI+ LM DG + RAMALRG+F+AGYPSSS AS Sbjct: 455 VKKCDIMEGIKVLMDDGEVHGRAMALRGIFEAGYPSSSDAS 495