BLASTX nr result
ID: Mentha25_contig00035262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035262 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22138.1| hypothetical protein MIMGU_mgv1a022144mg [Mimulus... 59 7e-07 gb|EYU22136.1| hypothetical protein MIMGU_mgv1a002226mg [Mimulus... 57 3e-06 gb|EYU22134.1| hypothetical protein MIMGU_mgv1a020201mg [Mimulus... 57 3e-06 gb|EYU22137.1| hypothetical protein MIMGU_mgv1a001781mg [Mimulus... 55 1e-05 >gb|EYU22138.1| hypothetical protein MIMGU_mgv1a022144mg [Mimulus guttatus] Length = 737 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -1 Query: 430 EQISAMIADVLAASLTNLPLVITTMCHRSAIEKREESMRKAFLL 299 EQ+S IAD+LAA LTNL VIT CHR+AIE+RE+S+RKA LL Sbjct: 632 EQLSVTIADILAACLTNLGHVITMKCHRNAIEEREKSVRKAALL 675 >gb|EYU22136.1| hypothetical protein MIMGU_mgv1a002226mg [Mimulus guttatus] Length = 699 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 430 EQISAMIADVLAASLTNLPLVITTMCHRSAIEKREESMRKAFLL 299 EQ+S MIAD+LAA TNL VIT CH +AIE+RE+S+RKA LL Sbjct: 596 EQLSVMIADILAACFTNLGHVITMKCHCNAIEEREKSVRKAALL 639 >gb|EYU22134.1| hypothetical protein MIMGU_mgv1a020201mg [Mimulus guttatus] Length = 590 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -1 Query: 430 EQISAMIADVLAASLTNLPLVITTMCHRSAIEKREESMRKAFLL 299 EQ+S IADVLAA LTNL VIT C R+AIE+RE+S+RKA LL Sbjct: 494 EQLSVTIADVLAACLTNLGHVITVTCRRNAIEEREKSVRKAALL 537 >gb|EYU22137.1| hypothetical protein MIMGU_mgv1a001781mg [Mimulus guttatus] Length = 760 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 430 EQISAMIADVLAASLTNLPLVITTMCHRSAIEKREESMRKA 308 E +S IADVLAA LTNL VIT CHR+AIE+REES+R A Sbjct: 641 EHLSVTIADVLAACLTNLGRVITIKCHRNAIEEREESVRNA 681