BLASTX nr result
ID: Mentha25_contig00035241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035241 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152417.1| PREDICTED: putative disease resistance prote... 62 8e-08 >ref|XP_004152417.1| PREDICTED: putative disease resistance protein At4g19050-like [Cucumis sativus] Length = 1078 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 1/87 (1%) Frame = +1 Query: 1 VGECPKLEHLISSPLTEQQQENEGHQNLETLHIKSCDKLKGIFE-KEDVVFEKLTELELS 177 + CP+LE L S + ++LE LH+K CD+LK I E KE+ + EKL L L Sbjct: 988 IDSCPQLETLFKS--------SHLSKSLEILHVKFCDRLKFICESKEECILEKLHSLNLV 1039 Query: 178 GLPEMQNVAMRARSLSTLRVEDCPSLE 258 LPE+ ++ ++ SL T + +CP LE Sbjct: 1040 ELPELTDIGLKLPSLRTANIRNCPKLE 1066