BLASTX nr result
ID: Mentha25_contig00035218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035218 (592 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529436.1| hypothetical protein RCOM_0545330 [Ricinus c... 59 1e-06 ref|XP_006585270.1| PREDICTED: F-box/kelch-repeat protein At3g23... 59 1e-06 ref|XP_007212916.1| hypothetical protein PRUPE_ppa022270mg, part... 57 3e-06 ref|XP_006406884.1| hypothetical protein EUTSA_v10022356mg, part... 56 9e-06 >ref|XP_002529436.1| hypothetical protein RCOM_0545330 [Ricinus communis] gi|223531113|gb|EEF32962.1| hypothetical protein RCOM_0545330 [Ricinus communis] Length = 376 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/51 (49%), Positives = 37/51 (72%) Frame = -2 Query: 480 LPVEIVMEILSWLPLKPLARAQLVCREWRALIQDHQFMEKHMKRNSYVHHF 328 LP+E+V+EILSWL + L R + VCR+W LIQD F+EKH+ R++ ++ Sbjct: 48 LPIELVIEILSWLSVDCLTRFKSVCRQWCELIQDRYFVEKHLSRSNLFSYY 98 >ref|XP_006585270.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Glycine max] Length = 402 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 2/91 (2%) Frame = -2 Query: 498 AKARRILPVEIVMEILSWLPLKPLARAQLVCREWRALIQDHQFMEKHMKRNSYVHHFYNI 319 AKA++ LP E+++EILSW+P+KPL R + V + W +LI F++ H++R+S H Sbjct: 2 AKAQQALPEELIVEILSWVPVKPLMRFKCVSKTWNSLIFHPTFVKLHLQRSSTNTHVLLT 61 Query: 318 SFSPDSTPESEWGFVTSM--AATACYF*RII 232 + P+ + + AAT C R++ Sbjct: 62 PEEEEDPPDDDEKVTDGLQRAATPCSVLRLL 92 >ref|XP_007212916.1| hypothetical protein PRUPE_ppa022270mg, partial [Prunus persica] gi|462408781|gb|EMJ14115.1| hypothetical protein PRUPE_ppa022270mg, partial [Prunus persica] Length = 361 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -2 Query: 480 LPVEIVMEILSWLPLKPLARAQLVCREWRALIQDHQFMEKHMKRNS 343 LP E+++EILSWL + L R + VC++W ALI+DH F+ KHM R S Sbjct: 23 LPFEMIIEILSWLTVDALLRMKSVCKKWCALIEDHHFIVKHMDRAS 68 >ref|XP_006406884.1| hypothetical protein EUTSA_v10022356mg, partial [Eutrema salsugineum] gi|557108030|gb|ESQ48337.1| hypothetical protein EUTSA_v10022356mg, partial [Eutrema salsugineum] Length = 221 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = -2 Query: 489 RRILPVEIVMEILSWLPLKPLARAQLVCREWRALIQDHQFMEKHM 355 RR LP E+V+EIL+ +P+K L R + VC+ WR+L+QD +F KHM Sbjct: 52 RRELPFELVVEILARIPVKDLVRFRCVCKSWRSLMQDERFYRKHM 96