BLASTX nr result
ID: Mentha25_contig00035038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00035038 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19751.1| hypothetical protein MIMGU_mgv1a014723mg [Mimulus... 56 4e-06 >gb|EYU19751.1| hypothetical protein MIMGU_mgv1a014723mg [Mimulus guttatus] Length = 180 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +3 Query: 3 KVARGYVKRKDRPQNLTFLDQIRLFVS--PASNPAQPEP 113 KVA+GYVKRKDRPQ++TFLDQIRLF+S +S+P EP Sbjct: 139 KVAKGYVKRKDRPQHITFLDQIRLFISSDTSSSPKSAEP 177