BLASTX nr result
ID: Mentha25_contig00034504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00034504 (586 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ62965.1| hypothetical protein BGT96224_A20676 [Blumeria gr... 70 3e-10 gb|EMR86712.1| putative siderophore biosynthesis protein [Botryo... 65 1e-08 emb|CCD53593.1| similar to siderophore biosynthesis protein [Bot... 65 1e-08 gb|ESZ98125.1| hypothetical protein SBOR_1504 [Sclerotinia borea... 64 3e-08 ref|XP_001587243.1| hypothetical protein SS1G_12273 [Sclerotinia... 61 3e-07 dbj|GAA88719.1| siderophore biosynthesis protein [Aspergillus ka... 60 6e-07 gb|EYE94481.1| putative siderophore biosynthesis protein [Asperg... 59 1e-06 gb|EHA26322.1| hypothetical protein ASPNIDRAFT_36253 [Aspergillu... 59 1e-06 emb|CAK32619.1| unnamed protein product [Aspergillus niger] 59 1e-06 ref|XP_001269742.1| siderophore biosynthesis protein, putative [... 58 2e-06 ref|XP_001265221.1| siderophore biosynthesis protein, putative [... 58 2e-06 gb|EON66903.1| hypothetical protein W97_06306 [Coniosporium apol... 57 3e-06 dbj|GAD92781.1| siderophore biosynthesis protein, putative [Byss... 57 5e-06 gb|EIT81779.1| acetyltransferase, including N-acetylase of ribos... 57 5e-06 ref|XP_002374424.1| siderophore biosynthesis protein, putative [... 57 5e-06 emb|CDM26507.1| Acyl-CoA N-acyltransferase [Penicillium roqueforti] 56 6e-06 gb|EKV11341.1| Siderophore biosynthesis protein, putative [Penic... 56 6e-06 gb|EGC42503.1| siderophore biosynthesis protein [Ajellomyces cap... 56 6e-06 gb|EEH02575.1| conserved hypothetical protein [Ajellomyces capsu... 56 6e-06 ref|XP_007291999.1| putative siderophore biosynthesis protein [M... 56 8e-06 >gb|EPQ62965.1| hypothetical protein BGT96224_A20676 [Blumeria graminis f. sp. tritici 96224] Length = 602 Score = 70.5 bits (171), Expect = 3e-10 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 +FIS+LQ+TGFLKERE++FPHKQSALM+L+RD FEAPVI Sbjct: 564 KFISHLQDTGFLKEREVTFPHKQSALMKLRRDNFEAPVI 602 >gb|EMR86712.1| putative siderophore biosynthesis protein [Botryotinia fuckeliana BcDW1] Length = 545 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 RFIS+LQE GF+KEREI+FPHKQSA M+L+R+ FEAPV+ Sbjct: 507 RFISHLQEAGFVKEREITFPHKQSAFMKLRRECFEAPVL 545 >emb|CCD53593.1| similar to siderophore biosynthesis protein [Botryotinia fuckeliana T4] Length = 545 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 RFIS+LQE GF+KEREI+FPHKQSA M+L+R+ FEAPV+ Sbjct: 507 RFISHLQEAGFVKEREITFPHKQSAFMKLRRECFEAPVL 545 >gb|ESZ98125.1| hypothetical protein SBOR_1504 [Sclerotinia borealis F-4157] Length = 545 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 RFIS+LQE GF+KEREI+FPHKQSA M+L+R+ FEAP + Sbjct: 507 RFISHLQEAGFVKEREITFPHKQSAFMKLRRECFEAPTV 545 >ref|XP_001587243.1| hypothetical protein SS1G_12273 [Sclerotinia sclerotiorum 1980] gi|154696329|gb|EDN96067.1| hypothetical protein SS1G_12273 [Sclerotinia sclerotiorum 1980 UF-70] Length = 173 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 RFIS+L+E GF+KEREI+FPHKQ+A M+L+R+ FEAP + Sbjct: 135 RFISHLKEAGFVKEREITFPHKQAAFMKLRRECFEAPAL 173 >dbj|GAA88719.1| siderophore biosynthesis protein [Aspergillus kawachii IFO 4308] Length = 518 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 + I+YLQE GF KE E+SFPHKQSALM++KRD +E P I Sbjct: 480 KLITYLQEAGFYKEGEVSFPHKQSALMKIKRDTWECPAI 518 >gb|EYE94481.1| putative siderophore biosynthesis protein [Aspergillus ruber CBS 135680] Length = 498 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 + ISYLQ++GF KE E++FPHKQSA+M++KRD +EAP I Sbjct: 460 KVISYLQKSGFYKEGEVTFPHKQSAVMKIKRDSWEAPAI 498 >gb|EHA26322.1| hypothetical protein ASPNIDRAFT_36253 [Aspergillus niger ATCC 1015] Length = 518 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 + I+YLQE GF KE E++FPHKQSALM++KRD +E P I Sbjct: 480 KLITYLQEAGFYKEGEVTFPHKQSALMKIKRDTWECPAI 518 >emb|CAK32619.1| unnamed protein product [Aspergillus niger] Length = 363 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 + I+YLQE GF KE E++FPHKQSALM++KRD +E P I Sbjct: 325 KLITYLQEAGFYKEGEVTFPHKQSALMKIKRDTWECPAI 363 >ref|XP_001269742.1| siderophore biosynthesis protein, putative [Aspergillus clavatus NRRL 1] gi|119397885|gb|EAW08316.1| siderophore biosynthesis protein, putative [Aspergillus clavatus NRRL 1] Length = 521 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 + I YLQ+ GF KE E++FPHKQSALM++KRD +E+PV+ Sbjct: 483 KIIRYLQDAGFYKEGEVTFPHKQSALMKIKRDSWESPVL 521 >ref|XP_001265221.1| siderophore biosynthesis protein, putative [Neosartorya fischeri NRRL 181] gi|119413383|gb|EAW23324.1| siderophore biosynthesis protein, putative [Neosartorya fischeri NRRL 181] Length = 522 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 + I YLQ GF KE E++FPHKQSALM++KRD +E+PV+ Sbjct: 484 KIIQYLQNAGFYKEGEVTFPHKQSALMKIKRDSWESPVL 522 >gb|EON66903.1| hypothetical protein W97_06306 [Coniosporium apollinis CBS 100218] Length = 535 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 540 SYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 +YL+E GF KEREISFPHKQS LM++KRD +EAP + Sbjct: 500 TYLEEVGFYKEREISFPHKQSNLMKIKRDAWEAPCL 535 >dbj|GAD92781.1| siderophore biosynthesis protein, putative [Byssochlamys spectabilis No. 5] Length = 538 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 546 FISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 FI++LQ GF KE E+SFPHKQSA M++KRD +EAP + Sbjct: 501 FITHLQRNGFYKEGEVSFPHKQSAAMKIKRDSWEAPAL 538 >gb|EIT81779.1| acetyltransferase, including N-acetylase of ribosomal protein [Aspergillus oryzae 3.042] Length = 516 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -2 Query: 552 SRFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 ++ + YLQ+ GF KE E+SFPHKQS LM++KRD +EAP I Sbjct: 477 TKVLEYLQKAGFYKEGEVSFPHKQSNLMKIKRDSWEAPAI 516 >ref|XP_002374424.1| siderophore biosynthesis protein, putative [Aspergillus flavus NRRL3357] gi|317144293|ref|XP_001820025.2| siderophore biosynthesis protein [Aspergillus oryzae RIB40] gi|220699303|gb|EED55642.1| siderophore biosynthesis protein, putative [Aspergillus flavus NRRL3357] Length = 516 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -2 Query: 552 SRFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 ++ + YLQ+ GF KE E+SFPHKQS LM++KRD +EAP I Sbjct: 477 TKVLEYLQKAGFYKEGEVSFPHKQSNLMKIKRDSWEAPAI 516 >emb|CDM26507.1| Acyl-CoA N-acyltransferase [Penicillium roqueforti] Length = 520 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 + I+YLQE GF KE E+SFPHK SA+MR+KR+ +E+P + Sbjct: 482 KLINYLQEAGFYKEGEVSFPHKHSAIMRIKREYWESPAL 520 >gb|EKV11341.1| Siderophore biosynthesis protein, putative [Penicillium digitatum PHI26] gi|425782010|gb|EKV19941.1| Siderophore biosynthesis protein, putative [Penicillium digitatum Pd1] Length = 522 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 + I+YLQE GF KE E+SFPHK SA+MR+KR+ +E+P + Sbjct: 484 KLINYLQEAGFYKEGEVSFPHKHSAIMRIKREYWESPAL 522 >gb|EGC42503.1| siderophore biosynthesis protein [Ajellomyces capsulatus H88] Length = 553 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -2 Query: 552 SRFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 ++ ISYLQ GF K+ E++FPHKQSALMR++R+ +EAP++ Sbjct: 514 TKIISYLQAVGFSKDGEVTFPHKQSALMRIRRENWEAPLL 553 >gb|EEH02575.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR] Length = 553 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = -2 Query: 552 SRFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 ++ ISYLQ GF K+ E++FPHKQSALMR++R+ +EAP++ Sbjct: 514 TKIISYLQAVGFSKDGEVTFPHKQSALMRIRRENWEAPLL 553 >ref|XP_007291999.1| putative siderophore biosynthesis protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406864697|gb|EKD17741.1| putative siderophore biosynthesis protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 545 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 549 RFISYLQETGFLKEREISFPHKQSALMRLKRDQFEAPVI 433 RFIS L GFLKE E++FPHKQSA ++L+R+ FEAP + Sbjct: 507 RFISLLNNAGFLKEGEVTFPHKQSAFVKLRRENFEAPFL 545