BLASTX nr result
ID: Mentha25_contig00034090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00034090 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39299.1| hypothetical protein MIMGU_mgv1a000479mg [Mimulus... 70 3e-10 gb|EYU30933.1| hypothetical protein MIMGU_mgv1a0271201mg, partia... 69 5e-10 >gb|EYU39299.1| hypothetical protein MIMGU_mgv1a000479mg [Mimulus guttatus] Length = 1127 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = -2 Query: 127 MALSFPRLSWLWLGGKEKEQ--NGSLINPINSLSDWGLGLRGE 5 MALSF R+SWLWLGGK+KE+ NG LIN +NSL +WGLGLRGE Sbjct: 1 MALSFTRISWLWLGGKDKEKVSNGGLINSLNSLGEWGLGLRGE 43 >gb|EYU30933.1| hypothetical protein MIMGU_mgv1a0271201mg, partial [Mimulus guttatus] Length = 163 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -2 Query: 127 MALSFPRLSWLWLGGKEKE---QNGSLINPINSLSDWGLGLRGE 5 MALSF + SWLWLGGKEKE NG L+N INS+ DWGLGLRGE Sbjct: 1 MALSFTKFSWLWLGGKEKEPVVSNGGLVNSINSVGDWGLGLRGE 44