BLASTX nr result
ID: Mentha25_contig00033977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00033977 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25244.1| hypothetical protein MIMGU_mgv1a018491mg [Mimulus... 74 3e-11 ref|XP_004234977.1| PREDICTED: putative aminoacrylate hydrolase ... 56 5e-06 >gb|EYU25244.1| hypothetical protein MIMGU_mgv1a018491mg [Mimulus guttatus] Length = 383 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/46 (69%), Positives = 43/46 (93%) Frame = +3 Query: 6 ANSSSYVVGSVEKLHVFMLYFFGLFILAFQYLRRGVMRLKPMKVES 143 A+SSS++V SVEKLH+F++YFFGLF+LAF+Y+RRGV RLKP++V S Sbjct: 335 ASSSSFIVESVEKLHIFLVYFFGLFVLAFEYIRRGVRRLKPVRVGS 380 >ref|XP_004234977.1| PREDICTED: putative aminoacrylate hydrolase RutD-like isoform 1 [Solanum lycopersicum] Length = 394 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/43 (55%), Positives = 36/43 (83%) Frame = +3 Query: 15 SSYVVGSVEKLHVFMLYFFGLFILAFQYLRRGVMRLKPMKVES 143 SS + VE+L +F+L+FFGLF+LAF+++RRGV RLKP++V + Sbjct: 349 SSVLADIVERLQMFLLFFFGLFMLAFEFMRRGVSRLKPVRVNA 391