BLASTX nr result
ID: Mentha25_contig00033959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00033959 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33640.1| hypothetical protein MIMGU_mgv1a002468mg [Mimulus... 60 2e-07 >gb|EYU33640.1| hypothetical protein MIMGU_mgv1a002468mg [Mimulus guttatus] Length = 670 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/46 (67%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = -1 Query: 134 PNAKRSSRPETPLLRWKFDEGN--EKNVAAEEEKSSGEVDRSSRRR 3 P+AKRSSRPETPLLRWKF+E N +V EEEKSSGE R RR Sbjct: 54 PSAKRSSRPETPLLRWKFEEPNVQTNSVVEEEEKSSGEAGRKISRR 99