BLASTX nr result
ID: Mentha25_contig00033730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00033730 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosph... 102 6e-20 ref|XP_002314452.2| mitochondrial substrate carrier family prote... 101 1e-19 ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 100 2e-19 gb|EYU43934.1| hypothetical protein MIMGU_mgv1a009865mg [Mimulus... 100 3e-19 ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosph... 100 3e-19 ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [A... 100 3e-19 ref|XP_007222579.1| hypothetical protein PRUPE_ppa008444mg [Prun... 100 3e-19 ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosph... 100 3e-19 ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putat... 99 8e-19 ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosph... 97 2e-18 ref|XP_007035559.1| Mitochondrial substrate carrier family prote... 97 2e-18 ref|XP_006389228.1| mitochondrial substrate carrier family prote... 97 3e-18 ref|XP_006389227.1| hypothetical protein POPTR_0034s00220g [Popu... 97 3e-18 ref|XP_007138898.1| hypothetical protein PHAVU_009G246900g [Phas... 96 5e-18 ref|XP_006848889.1| hypothetical protein AMTR_s00161p00018520 [A... 96 5e-18 ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosph... 94 1e-17 ref|XP_004172379.1| PREDICTED: mitochondrial thiamine pyrophosph... 94 1e-17 ref|XP_004143086.1| PREDICTED: mitochondrial thiamine pyrophosph... 94 1e-17 ref|XP_006586931.1| PREDICTED: mitochondrial thiamine pyrophosph... 94 2e-17 ref|XP_006586930.1| PREDICTED: mitochondrial thiamine pyrophosph... 94 2e-17 >ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 329 Score = 102 bits (254), Expect = 6e-20 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNMYD LR+IL EGWAGLYKGI PSIVKAAPAGAVTFVAYE+TSDWLES+LT Sbjct: 275 AYKNMYDGLRRILLEEGWAGLYKGIVPSIVKAAPAGAVTFVAYEYTSDWLESILT 329 >ref|XP_002314452.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550328947|gb|EEF00623.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 341 Score = 101 bits (251), Expect = 1e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY+NM+DALR+IL EGWAGLYKGI PS VKAAPAGAVTFVAYEFTSDWLES+LT Sbjct: 287 AYRNMFDALRRILQTEGWAGLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLESILT 341 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 100 bits (249), Expect = 2e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY NMYDALRQIL EGWAGLYKGI PSI+K+APAGAVTFVAYEFTSDWLES++T Sbjct: 276 AYTNMYDALRQILLVEGWAGLYKGIVPSIIKSAPAGAVTFVAYEFTSDWLESMVT 330 >gb|EYU43934.1| hypothetical protein MIMGU_mgv1a009865mg [Mimulus guttatus] Length = 329 Score = 100 bits (248), Expect = 3e-19 Identities = 47/55 (85%), Positives = 50/55 (90%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNMYDAL +I+ EGWAGLYKGI PSIVKAAPAGAVTFVAYEFTSDWLES+ T Sbjct: 275 AYKNMYDALTRIMQAEGWAGLYKGIVPSIVKAAPAGAVTFVAYEFTSDWLESVST 329 >ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 331 Score = 100 bits (248), Expect = 3e-19 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNMYD LR+IL EGWAGLYKGI PS++KAAPAGAVTFVAYE+TSDWLES LT Sbjct: 277 AYKNMYDGLRRILIEEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSDWLESKLT 331 >ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] gi|548859284|gb|ERN16985.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] Length = 369 Score = 100 bits (248), Expect = 3e-19 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNM+DALR I+ EGWAGLYKGI PSI+KAAPAGAVTFVAYE+TSDWLES+LT Sbjct: 315 AYKNMWDALRGIVQAEGWAGLYKGIVPSIIKAAPAGAVTFVAYEYTSDWLESILT 369 >ref|XP_007222579.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] gi|462419515|gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] Length = 331 Score = 100 bits (248), Expect = 3e-19 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY+NM+DALR+IL +EGWAGLYKGI PS VKAAPAGAVTFVAYE+TSDWLES LT Sbjct: 277 AYRNMFDALRRILQKEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLESALT 331 >ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum lycopersicum] Length = 331 Score = 100 bits (248), Expect = 3e-19 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNMYD LR+IL EGWAGLYKGI PS++KAAPAGAVTFVAYE+TSDWLES LT Sbjct: 277 AYKNMYDGLRRILIEEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSDWLESKLT 331 >ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] gi|223543992|gb|EEF45518.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] Length = 331 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY+NM DALR+IL EGWAGLYKGI PS +KAAPAGAVTFVAYEFTSDWLES+LT Sbjct: 277 AYRNMADALRRILQAEGWAGLYKGILPSTIKAAPAGAVTFVAYEFTSDWLESILT 331 >ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cicer arietinum] Length = 333 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY+NM+D LR+IL EGWAGLYKGI PS VKAAPAGAVTFVAYE TSDWLES+LT Sbjct: 279 AYRNMFDGLRRILQMEGWAGLYKGIVPSTVKAAPAGAVTFVAYELTSDWLESILT 333 >ref|XP_007035559.1| Mitochondrial substrate carrier family protein [Theobroma cacao] gi|508714588|gb|EOY06485.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 330 Score = 97.1 bits (240), Expect = 2e-18 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY NM+DALR+IL EGW GLYKGI PS +KAAPAGAVTFVAYEFTSDWLES+LT Sbjct: 276 AYMNMFDALRRILQLEGWHGLYKGIVPSTIKAAPAGAVTFVAYEFTSDWLESILT 330 >ref|XP_006389228.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550311967|gb|ERP48142.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 342 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNM+DAL +IL EGWAGLYKGI PS VKAAPAGAVTF+AYEFTSDWLES+ T Sbjct: 288 AYKNMFDALSRILQMEGWAGLYKGIVPSTVKAAPAGAVTFLAYEFTSDWLESIST 342 >ref|XP_006389227.1| hypothetical protein POPTR_0034s00220g [Populus trichocarpa] gi|550311966|gb|ERP48141.1| hypothetical protein POPTR_0034s00220g [Populus trichocarpa] Length = 305 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNM+DAL +IL EGWAGLYKGI PS VKAAPAGAVTF+AYEFTSDWLES+ T Sbjct: 251 AYKNMFDALSRILQMEGWAGLYKGIVPSTVKAAPAGAVTFLAYEFTSDWLESIST 305 >ref|XP_007138898.1| hypothetical protein PHAVU_009G246900g [Phaseolus vulgaris] gi|561011985|gb|ESW10892.1| hypothetical protein PHAVU_009G246900g [Phaseolus vulgaris] Length = 328 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY NM+DA+++IL +EGWAGLYKGI PS VKAAPA AVTFVAYE TSDWLESLLT Sbjct: 274 AYNNMFDAIKRILQKEGWAGLYKGIVPSTVKAAPANAVTFVAYELTSDWLESLLT 328 >ref|XP_006848889.1| hypothetical protein AMTR_s00161p00018520 [Amborella trichopoda] gi|548852342|gb|ERN10470.1| hypothetical protein AMTR_s00161p00018520 [Amborella trichopoda] Length = 83 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNM+DAL I+ EGWAGLYKGI PSI+KAA AGAVTFVAYE+TSDWLES+LT Sbjct: 29 AYKNMWDALHSIVQAEGWAGLYKGIVPSIIKAASAGAVTFVAYEYTSDWLESILT 83 >ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Fragaria vesca subsp. vesca] Length = 330 Score = 94.4 bits (233), Expect = 1e-17 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLL 164 AY NM DALR+I+ +EGWAGLYKGI PS VKAAPAGAVTFVAYE+TSDWLES L Sbjct: 277 AYSNMVDALRRIVQKEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLESRL 330 >ref|XP_004172379.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like, partial [Cucumis sativus] Length = 219 Score = 94.4 bits (233), Expect = 1e-17 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY+NM+DALR+IL +EG AGLYKGI PS VKAAPAGAVTFVAYE TSDWLES+LT Sbjct: 161 AYRNMFDALRRILKKEGTAGLYKGIIPSTVKAAPAGAVTFVAYEITSDWLESILT 215 >ref|XP_004143086.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cucumis sativus] Length = 340 Score = 94.4 bits (233), Expect = 1e-17 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AY+NM+DALR+IL +EG AGLYKGI PS VKAAPAGAVTFVAYE TSDWLES+LT Sbjct: 282 AYRNMFDALRRILKKEGTAGLYKGIIPSTVKAAPAGAVTFVAYEITSDWLESILT 336 >ref|XP_006586931.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X3 [Glycine max] Length = 263 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNM DA+++IL EGWAGLYKGI PS VKAAPAGAVTFVAYE T DWLES+LT Sbjct: 209 AYKNMLDAMKRILQMEGWAGLYKGILPSTVKAAPAGAVTFVAYELTVDWLESILT 263 >ref|XP_006586930.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Glycine max] Length = 277 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = +3 Query: 3 AYKNMYDALRQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 167 AYKNM DA+++IL EGWAGLYKGI PS VKAAPAGAVTFVAYE T DWLES+LT Sbjct: 223 AYKNMLDAMKRILQMEGWAGLYKGILPSTVKAAPAGAVTFVAYELTVDWLESILT 277