BLASTX nr result
ID: Mentha25_contig00033681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00033681 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ64053.1| Cytochrome [Blumeria graminis f. sp. tritici 96224] 108 1e-21 emb|CCU77207.1| putative cytochrome c oxidase family protein [Bl... 107 2e-21 gb|EPE30664.1| hypothetical protein GLAREA_03631 [Glarea lozoyen... 105 8e-21 ref|XP_001551311.1| hypothetical protein BC1G_10051 [Botryotinia... 103 3e-20 ref|XP_007292587.1| cytochrome c oxidase family protein [Marsson... 102 4e-20 ref|XP_001598813.1| predicted protein [Sclerotinia sclerotiorum ... 102 4e-20 ref|XP_001263018.1| cytochrome c oxidase family protein [Neosart... 95 1e-17 tpe|CBF87023.1| TPA: cytochrome c oxidase family protein (AFU_or... 94 1e-17 gb|EME46595.1| hypothetical protein DOTSEDRAFT_70564 [Dothistrom... 94 2e-17 ref|XP_001271393.1| cytochrome c oxidase family protein [Aspergi... 94 2e-17 ref|XP_754182.1| cytochrome c oxidase family protein [Aspergillu... 93 3e-17 gb|EMF14194.1| cytochrome-c oxidase, subunit VIIa [Sphaerulina m... 93 4e-17 ref|XP_002487849.1| cytochrome c oxidase family protein [Talarom... 92 6e-17 ref|XP_002153577.1| cytochrome c oxidase family protein [Talarom... 92 7e-17 ref|XP_003190324.1| cytochrome c oxidase family protein [Aspergi... 91 1e-16 ref|XP_001246204.1| predicted protein [Coccidioides immitis RS] ... 91 1e-16 emb|CDM28264.1| Cytochrome c oxidase subunit 7A [Penicillium roq... 90 4e-16 ref|XP_001393715.1| cytochrome c oxidase family protein [Aspergi... 90 4e-16 gb|ETN45418.1| hypothetical protein HMPREF1541_09249 [Cyphelloph... 89 6e-16 ref|XP_001536221.1| predicted protein [Ajellomyces capsulatus NA... 89 6e-16 >gb|EPQ64053.1| Cytochrome [Blumeria graminis f. sp. tritici 96224] Length = 61 Score = 108 bits (269), Expect = 1e-21 Identities = 51/60 (85%), Positives = 54/60 (90%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANAS 113 MAIAPITGMLRRGL+LDLSIAFG+GTS GYLFWYG H+P VRKRD YYTKLEE R ANAS Sbjct: 1 MAIAPITGMLRRGLILDLSIAFGVGTSVGYLFWYGFHIPNVRKRDLYYTKLEEQRAANAS 60 >emb|CCU77207.1| putative cytochrome c oxidase family protein [Blumeria graminis f. sp. hordei DH14] Length = 61 Score = 107 bits (266), Expect = 2e-21 Identities = 50/60 (83%), Positives = 54/60 (90%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANAS 113 MAIAPITGMLRRGL+LDLSIAFG+GTS GYL+WYG H+P VRKRD YYTKLEE R ANAS Sbjct: 1 MAIAPITGMLRRGLILDLSIAFGVGTSVGYLYWYGFHIPNVRKRDLYYTKLEEQRAANAS 60 >gb|EPE30664.1| hypothetical protein GLAREA_03631 [Glarea lozoyensis ATCC 20868] Length = 61 Score = 105 bits (261), Expect = 8e-21 Identities = 49/61 (80%), Positives = 55/61 (90%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANAS 113 MAI PITGMLRRGLVLDLS+AFGLGTSFGYLFWYG HVP VR+RD +Y+KLE+ R ANA+ Sbjct: 1 MAIKPITGMLRRGLVLDLSVAFGLGTSFGYLFWYGYHVPAVRRRDLFYSKLEDQRAANAA 60 Query: 112 A 110 A Sbjct: 61 A 61 >ref|XP_001551311.1| hypothetical protein BC1G_10051 [Botryotinia fuckeliana B05.10] gi|347828472|emb|CCD44169.1| similar to cytochrome c oxidase family protein [Botryotinia fuckeliana T4] Length = 61 Score = 103 bits (256), Expect = 3e-20 Identities = 48/61 (78%), Positives = 53/61 (86%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANAS 113 MAI PITGMLRRGLVLDLS+AFGLGT+FGY FWYG HVP VRKRD +Y KLE+ R ANA+ Sbjct: 1 MAIKPITGMLRRGLVLDLSVAFGLGTTFGYAFWYGYHVPAVRKRDAFYAKLEDQRAANAA 60 Query: 112 A 110 A Sbjct: 61 A 61 >ref|XP_007292587.1| cytochrome c oxidase family protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406864075|gb|EKD17121.1| cytochrome c oxidase family protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 61 Score = 102 bits (255), Expect = 4e-20 Identities = 48/61 (78%), Positives = 53/61 (86%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANAS 113 MAI PITGMLRRGLVLDLS+AFGLGT+FGY FWYG HVP V KRD YY+KLE+ R ANA+ Sbjct: 1 MAIKPITGMLRRGLVLDLSVAFGLGTTFGYAFWYGFHVPAVAKRDAYYSKLEDKRAANAA 60 Query: 112 A 110 A Sbjct: 61 A 61 >ref|XP_001598813.1| predicted protein [Sclerotinia sclerotiorum 1980] gi|154691761|gb|EDN91499.1| predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 61 Score = 102 bits (255), Expect = 4e-20 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANAS 113 MAI PITGMLRRGLVLDLS+AFG+GT+FGY FWYG HVP VRKRD +Y+KLE+ R ANA+ Sbjct: 1 MAIKPITGMLRRGLVLDLSVAFGIGTTFGYAFWYGYHVPAVRKRDAFYSKLEDQRAANAA 60 Query: 112 A 110 A Sbjct: 61 A 61 >ref|XP_001263018.1| cytochrome c oxidase family protein [Neosartorya fischeri NRRL 181] gi|119411178|gb|EAW21121.1| cytochrome c oxidase family protein [Neosartorya fischeri NRRL 181] Length = 63 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = -3 Query: 295 AMAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANA 116 A AI PITGMLRRGLVLDLS AFG GT+FGYL+WYG H+P+VR RD YYT+LE+ R A Sbjct: 2 AAAIPPITGMLRRGLVLDLSTAFGFGTTFGYLWWYGYHLPRVRARDAYYTRLEKERAAQQ 61 Query: 115 SA 110 +A Sbjct: 62 AA 63 >tpe|CBF87023.1| TPA: cytochrome c oxidase family protein (AFU_orthologue; AFUA_3G14440) [Aspergillus nidulans FGSC A4] Length = 62 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -3 Query: 295 AMAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 A AIAPITGMLRRGLVLDLS AFG GT+FGYL+WYG H+P+VR RD YY +LE+ R A Sbjct: 2 ATAIAPITGMLRRGLVLDLSTAFGFGTTFGYLWWYGYHLPRVRARDEYYNRLEQERAA 59 >gb|EME46595.1| hypothetical protein DOTSEDRAFT_70564 [Dothistroma septosporum NZE10] Length = 62 Score = 94.0 bits (232), Expect = 2e-17 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 M I PITGMLRRGLVLDLS+AFGLGTSFGY +WYG HVP VR+RD +Y KLE+ R + Sbjct: 1 MPIKPITGMLRRGLVLDLSVAFGLGTSFGYFWWYGFHVPSVRRRDQFYAKLEDERAS 57 >ref|XP_001271393.1| cytochrome c oxidase family protein [Aspergillus clavatus NRRL 1] gi|119399539|gb|EAW09967.1| cytochrome c oxidase family protein [Aspergillus clavatus NRRL 1] Length = 62 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -3 Query: 295 AMAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 A AI PITGMLRRGLVLDLS AFG GT+FGYL+WYG H+P+VR RD YYT+LE+ R A Sbjct: 2 AAAIPPITGMLRRGLVLDLSTAFGFGTTFGYLWWYGYHLPRVRARDSYYTRLEQERAA 59 >ref|XP_754182.1| cytochrome c oxidase family protein [Aspergillus fumigatus Af293] gi|66851819|gb|EAL92144.1| cytochrome c oxidase family protein [Aspergillus fumigatus Af293] gi|159127200|gb|EDP52315.1| cytochrome c oxidase family protein [Aspergillus fumigatus A1163] Length = 62 Score = 93.2 bits (230), Expect = 3e-17 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -3 Query: 295 AMAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 A AI PITGMLRRGLVLDLS AFG GT+FGYL+WYG H+P+VR RD YYT+LE+ R A Sbjct: 2 AAAIPPITGMLRRGLVLDLSTAFGFGTTFGYLWWYGYHLPRVRARDAYYTRLEKERAA 59 >gb|EMF14194.1| cytochrome-c oxidase, subunit VIIa [Sphaerulina musiva SO2202] Length = 61 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = -3 Query: 286 IAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANA 116 + PITGMLRRGLVLDLS+AFGLGTSFGYL+WYG HVP VR+RD +Y KLE+ R ANA Sbjct: 2 VKPITGMLRRGLVLDLSVAFGLGTSFGYLWWYGFHVPSVRRRDVFYAKLEDQR-ANA 57 >ref|XP_002487849.1| cytochrome c oxidase family protein [Talaromyces stipitatus ATCC 10500] gi|218712770|gb|EED12195.1| cytochrome c oxidase family protein [Talaromyces stipitatus ATCC 10500] Length = 62 Score = 92.4 bits (228), Expect = 6e-17 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -3 Query: 295 AMAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 A AI PITGMLRRGLVLDLS AFGLGT+FGYL+WYG H+P+VR RD++Y +LE+ R A Sbjct: 2 AAAIPPITGMLRRGLVLDLSTAFGLGTTFGYLWWYGYHLPRVRARDNHYARLEQERAA 59 >ref|XP_002153577.1| cytochrome c oxidase family protein [Talaromyces marneffei ATCC 18224] gi|210065097|gb|EEA19192.1| cytochrome c oxidase family protein [Talaromyces marneffei ATCC 18224] Length = 62 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = -3 Query: 295 AMAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 A IAPITG+LRRGLVLDLS AFGLGT+FGYL+WYG H+P+VR RD+YY +LE R A Sbjct: 2 AATIAPITGILRRGLVLDLSTAFGLGTTFGYLWWYGYHLPRVRARDNYYARLEAERAA 59 >ref|XP_003190324.1| cytochrome c oxidase family protein [Aspergillus oryzae RIB40] Length = 61 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/56 (73%), Positives = 48/56 (85%) Frame = -3 Query: 289 AIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 AIAPITGMLRR LVLDLS AFG GT+FGYL+WYG H+P+VR RD+YY +LE+ R A Sbjct: 3 AIAPITGMLRRNLVLDLSTAFGFGTTFGYLWWYGYHLPRVRARDNYYVRLEQERAA 58 >ref|XP_001246204.1| predicted protein [Coccidioides immitis RS] gi|303315597|ref|XP_003067806.1| cytochrome c oxidase subunit 7A precursor, putative [Coccidioides posadasii C735 delta SOWgp] gi|240107476|gb|EER25661.1| cytochrome c oxidase subunit 7A precursor, putative [Coccidioides posadasii C735 delta SOWgp] gi|320035334|gb|EFW17275.1| hypothetical protein CPSG_05718 [Coccidioides posadasii str. Silveira] gi|392869052|gb|EAS30418.2| hypothetical protein CIMG_05645 [Coccidioides immitis RS] Length = 61 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/60 (68%), Positives = 49/60 (81%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANAS 113 MAI PITGMLR+GLVLD+S AFGLGT+FGYL+WYG H+P+VR RDH Y LE R + A+ Sbjct: 1 MAIQPITGMLRKGLVLDISTAFGLGTTFGYLWWYGYHLPRVRARDHLYATLEAERASEAA 60 >emb|CDM28264.1| Cytochrome c oxidase subunit 7A [Penicillium roqueforti] Length = 62 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = -3 Query: 289 AIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 AI PITGMLRRGLVLDLS AFG GT+FGYL+WYG H+P+VR+RD YY +LE R A Sbjct: 4 AIPPITGMLRRGLVLDLSTAFGFGTTFGYLWWYGYHLPRVRERDTYYARLEVERAA 59 >ref|XP_001393715.1| cytochrome c oxidase family protein [Aspergillus niger CBS 513.88] gi|134078260|emb|CAK96841.1| unnamed protein product [Aspergillus niger] Length = 61 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = -3 Query: 289 AIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVA 122 ++APITGMLRR LVLDLS AFG GT+FGYL+WYG H+P+VR RD+YYT+LE R A Sbjct: 3 SVAPITGMLRRTLVLDLSTAFGFGTTFGYLWWYGFHLPRVRARDNYYTRLEAERAA 58 >gb|ETN45418.1| hypothetical protein HMPREF1541_09249 [Cyphellophora europaea CBS 101466] Length = 62 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/59 (67%), Positives = 48/59 (81%) Frame = -3 Query: 292 MAIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGRVANA 116 M + PITGMLRRGLVLDL+IA GLGT+FGYL+WYG H+P+VR RD +Y KLE+ R A Sbjct: 1 MPVKPITGMLRRGLVLDLAIAGGLGTTFGYLWWYGYHLPRVRARDQFYAKLEDQRAREA 59 >ref|XP_001536221.1| predicted protein [Ajellomyces capsulatus NAm1] gi|150409795|gb|EDN05235.1| predicted protein [Ajellomyces capsulatus NAm1] gi|225554961|gb|EEH03255.1| hypothetical protein HCBG_08587 [Ajellomyces capsulatus G186AR] gi|239614500|gb|EEQ91487.1| predicted protein [Ajellomyces dermatitidis ER-3] gi|240274333|gb|EER37850.1| hypothetical protein HCDG_08109 [Ajellomyces capsulatus H143] Length = 62 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/54 (75%), Positives = 45/54 (83%) Frame = -3 Query: 289 AIAPITGMLRRGLVLDLSIAFGLGTSFGYLFWYGVHVPKVRKRDHYYTKLEEGR 128 AI PITGMLRRGLVLDLS AFGLGT+FGYLFWYG H+P+VR RD Y +LE R Sbjct: 3 AIQPITGMLRRGLVLDLSTAFGLGTTFGYLFWYGYHLPRVRARDRLYARLETER 56