BLASTX nr result
ID: Mentha25_contig00032770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032770 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39239.1| hypothetical protein MIMGU_mgv1a001034mg [Mimulus... 54 2e-08 >gb|EYU39239.1| hypothetical protein MIMGU_mgv1a001034mg [Mimulus guttatus] Length = 907 Score = 54.3 bits (129), Expect(2) = 2e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 187 MKVYHLEVLSSIREDKHSAINLEAAKWELADAE 285 MK++H E LSSI+ED+H A+NLEA KWELADAE Sbjct: 743 MKLHHQETLSSIQEDRHMAMNLEATKWELADAE 775 Score = 29.6 bits (65), Expect(2) = 2e-08 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +3 Query: 66 SLEALKSRIAQSEEQV 113 SLE+LKSRIAQSEEQ+ Sbjct: 728 SLESLKSRIAQSEEQM 743