BLASTX nr result
ID: Mentha25_contig00032723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032723 (683 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222072.1| hypothetical protein PRUPE_ppa007522mg [Prun... 58 3e-06 ref|XP_006356059.1| PREDICTED: uncharacterized protein LOC102598... 58 3e-06 >ref|XP_007222072.1| hypothetical protein PRUPE_ppa007522mg [Prunus persica] gi|462419008|gb|EMJ23271.1| hypothetical protein PRUPE_ppa007522mg [Prunus persica] Length = 365 Score = 58.2 bits (139), Expect = 3e-06 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = +1 Query: 1 SYKVHFKDIRPSLDWSLELGWTLPAQEDGTDHPRTRLIKPINQ 129 SY+V KD+RPSLDWS E GWT+P E HP R++KP NQ Sbjct: 136 SYEVSCKDLRPSLDWSPENGWTVPTTESENGHPCARIMKPCNQ 178 >ref|XP_006356059.1| PREDICTED: uncharacterized protein LOC102598974 [Solanum tuberosum] Length = 374 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/51 (49%), Positives = 36/51 (70%) Frame = +1 Query: 4 YKVHFKDIRPSLDWSLELGWTLPAQEDGTDHPRTRLIKPINQAIGRVEESK 156 Y+V FKD+RPSL+WS + GWT+P +DG +LI+P+NQA+ V E + Sbjct: 154 YEVSFKDLRPSLEWSPDFGWTVPTSQDGV-RRCAQLIQPVNQALHSVSEGR 203