BLASTX nr result
ID: Mentha25_contig00032617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032617 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG08953.1| hypothetical protein MPH_14093 [Macrophomina phas... 56 6e-06 ref|XP_001596107.1| hypothetical protein SS1G_02323 [Sclerotinia... 56 6e-06 >gb|EKG08953.1| hypothetical protein MPH_14093 [Macrophomina phaseolina MS6] Length = 249 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/52 (44%), Positives = 36/52 (69%) Frame = +2 Query: 35 RHVRVEYHYVTQEVYNKNIEVRYIPSSLNPADGFTKPLSSDSFRKFVKNLGL 190 +H+ V YH++ +V K I++ YIPS+ ADG TKPLS F++F++ +GL Sbjct: 194 KHIEVYYHFIRHQVKEKTIKLNYIPSNNMIADGLTKPLSKLKFQRFIQQIGL 245 >ref|XP_001596107.1| hypothetical protein SS1G_02323 [Sclerotinia sclerotiorum 1980] gi|154699731|gb|EDN99469.1| hypothetical protein SS1G_02323 [Sclerotinia sclerotiorum 1980 UF-70] Length = 1519 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/57 (45%), Positives = 35/57 (61%) Frame = +2 Query: 20 MTSGRRHVRVEYHYVTQEVYNKNIEVRYIPSSLNPADGFTKPLSSDSFRKFVKNLGL 190 +T +H+ V YH+V +EV YIP+ ADG TKPL D+FRKFV+ LG+ Sbjct: 1460 LTDRSKHIDVAYHHVRDLAEKGMLEVSYIPTDKMVADGLTKPLGKDAFRKFVEMLGM 1516