BLASTX nr result
ID: Mentha25_contig00032605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032605 (612 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35896.1| hypothetical protein MIMGU_mgv1a009472mg [Mimulus... 67 4e-09 >gb|EYU35896.1| hypothetical protein MIMGU_mgv1a009472mg [Mimulus guttatus] Length = 340 Score = 67.0 bits (162), Expect = 4e-09 Identities = 37/81 (45%), Positives = 45/81 (55%) Frame = +1 Query: 370 NTMFGSKISSIRHVHSKQNDPDLNRDFFVQLWLHDKKKTRPTAKLRNKDLQLGSSDEKSV 549 N M GS R+VH+ +ND DLNRDFF QLW+ DKKK +P K + K L+ S E V Sbjct: 2 NWMRGSVSMYRRYVHTAKNDGDLNRDFFAQLWIADKKKPKPYGKGKYKVLKSSGSGETFV 61 Query: 550 DLRTFPKLLERMLCGKAALDE 612 D RT LER + E Sbjct: 62 DGRTISGFLERAFSAASVASE 82