BLASTX nr result
ID: Mentha25_contig00032389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00032389 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30075.1| hypothetical protein MIMGU_mgv1a016420mg [Mimulus... 57 3e-06 >gb|EYU30075.1| hypothetical protein MIMGU_mgv1a016420mg [Mimulus guttatus] Length = 122 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/57 (54%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +3 Query: 21 SRWSPARKTRLFA--ASPYLTGPTGPASKAKGRDEAGSSIAEEEKRVVHTGPNPLHN 185 SRWSPARK R F A+P S + RDEA E+EKR+VHTGPNPLHN Sbjct: 69 SRWSPARKQRFFTTTAAPSYHARAPTTSSSSTRDEANY---EDEKRLVHTGPNPLHN 122