BLASTX nr result
ID: Mentha25_contig00030486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00030486 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006493901.1| PREDICTED: uncharacterized protein LOC102626... 77 2e-12 ref|XP_006421449.1| hypothetical protein CICLE_v10004353mg [Citr... 77 2e-12 ref|XP_002526728.1| catalytic, putative [Ricinus communis] gi|22... 76 4e-12 ref|XP_006349551.1| PREDICTED: uncharacterized protein LOC102592... 74 2e-11 ref|XP_002308967.2| exostosin family protein [Populus trichocarp... 74 2e-11 emb|CBI29877.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002277596.1| PREDICTED: uncharacterized protein LOC100267... 74 2e-11 gb|EPS72577.1| hypothetical protein M569_02178, partial [Genlise... 73 5e-11 ref|XP_004234838.1| PREDICTED: uncharacterized protein LOC101249... 72 6e-11 ref|XP_007028839.1| Exostosin family protein isoform 1 [Theobrom... 72 8e-11 ref|XP_003520526.1| PREDICTED: uncharacterized protein LOC100775... 70 3e-10 gb|EPS66708.1| adenylosuccinate synthetase, partial [Genlisea au... 69 5e-10 ref|NP_974452.1| exostosin family protein [Arabidopsis thaliana]... 69 5e-10 ref|XP_003519065.1| PREDICTED: uncharacterized protein LOC100783... 69 5e-10 ref|NP_191322.3| exostosin family protein [Arabidopsis thaliana]... 69 5e-10 emb|CAB41192.1| putative protein [Arabidopsis thaliana] 69 5e-10 ref|XP_004307567.1| PREDICTED: uncharacterized protein LOC101304... 69 7e-10 gb|EPS66816.1| hypothetical protein M569_07961, partial [Genlise... 68 1e-09 ref|XP_007201939.1| hypothetical protein PRUPE_ppa001595mg [Prun... 68 1e-09 ref|XP_003535163.1| PREDICTED: uncharacterized protein LOC100807... 68 1e-09 >ref|XP_006493901.1| PREDICTED: uncharacterized protein LOC102626477 isoform X1 [Citrus sinensis] Length = 791 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECL 162 G +WA +F ++ DD FTTL+QILHYKLHNDPWR + KKDFG+P+ECL Sbjct: 739 GRMNDWAVEFLKLREDDVFTTLIQILHYKLHNDPWRRELVHQKKDFGIPQECL 791 >ref|XP_006421449.1| hypothetical protein CICLE_v10004353mg [Citrus clementina] gi|557523322|gb|ESR34689.1| hypothetical protein CICLE_v10004353mg [Citrus clementina] Length = 791 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECL 162 G +WA +F ++ DD FTTL+QILHYKLHNDPWR + KKDFG+P+ECL Sbjct: 739 GRMNDWAVEFLKLREDDVFTTLIQILHYKLHNDPWRRELVHQKKDFGIPQECL 791 >ref|XP_002526728.1| catalytic, putative [Ricinus communis] gi|223533917|gb|EEF35642.1| catalytic, putative [Ricinus communis] Length = 728 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLVT 168 G E+W +F ++ DD FTT +QILHYKLHNDPWR + KKDFGLP+ECL T Sbjct: 673 GHEEDWEVEFLQLVNDDVFTTFIQILHYKLHNDPWRRQLSHLKKDFGLPQECLRT 727 >ref|XP_006349551.1| PREDICTED: uncharacterized protein LOC102592127 [Solanum tuberosum] Length = 790 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLV 165 G E+W KF +++ DD F T +Q+LHYKLHND WR KK+FGLPKECL+ Sbjct: 734 GSVEDWGLKFSQLKEDDVFATFIQVLHYKLHNDTWRQQLILQKKEFGLPKECLI 787 >ref|XP_002308967.2| exostosin family protein [Populus trichocarpa] gi|550335517|gb|EEE92490.2| exostosin family protein [Populus trichocarpa] Length = 793 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLV 165 G E+WA +F + DD T VQ+LHYKLHNDPWR KKDFGLP+ECL+ Sbjct: 737 GYVEDWAVEFLRLTEDDVVATFVQVLHYKLHNDPWRRQLGSQKKDFGLPQECLM 790 >emb|CBI29877.3| unnamed protein product [Vitis vinifera] Length = 822 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLV 165 G E+WA + ++ DD F TL+Q+LHYKLHNDPWR A KKDFGL +ECL+ Sbjct: 766 GNVEDWAVQLLQLSEDDVFATLIQVLHYKLHNDPWRQQLAHLKKDFGLAQECLI 819 >ref|XP_002277596.1| PREDICTED: uncharacterized protein LOC100267584 [Vitis vinifera] Length = 794 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLV 165 G E+WA + ++ DD F TL+Q+LHYKLHNDPWR A KKDFGL +ECL+ Sbjct: 738 GNVEDWAVQLLQLSEDDVFATLIQVLHYKLHNDPWRQQLAHLKKDFGLAQECLI 791 >gb|EPS72577.1| hypothetical protein M569_02178, partial [Genlisea aurea] Length = 708 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = +1 Query: 1 IGLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRID-SAPPKKDFGLPKEC 159 I L E WA +F E++GDD F TL+QILHYKLHNDPWR S+ K +GLP EC Sbjct: 655 IRLVEKWAKEFLELQGDDVFATLMQILHYKLHNDPWRRKISSEKNKQYGLPAEC 708 >ref|XP_004234838.1| PREDICTED: uncharacterized protein LOC101249053 [Solanum lycopersicum] Length = 785 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLV 165 G E+W KF ++E DD F T +Q+LHYKLHND WR KK+FGLPKECL+ Sbjct: 730 GSVEDWGLKFLQLEEDDVFATFIQVLHYKLHNDTWR-QKLLQKKEFGLPKECLI 782 >ref|XP_007028839.1| Exostosin family protein isoform 1 [Theobroma cacao] gi|590636390|ref|XP_007028840.1| Exostosin family protein isoform 1 [Theobroma cacao] gi|508717444|gb|EOY09341.1| Exostosin family protein isoform 1 [Theobroma cacao] gi|508717445|gb|EOY09342.1| Exostosin family protein isoform 1 [Theobroma cacao] Length = 794 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLV 165 G E+WA +F + DD FTT +Q+LHYKLHNDPWR A KK++G+P ECL+ Sbjct: 738 GRLEDWAVQFLQQTEDDVFTTFLQVLHYKLHNDPWRRQLAHLKKEYGVPPECLI 791 >ref|XP_003520526.1| PREDICTED: uncharacterized protein LOC100775594 [Glycine max] Length = 761 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/55 (52%), Positives = 38/55 (69%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLVT 168 G +WA +F ++ DD FTT +Q+LHYKLHNDPWR KK FGLP +CL++ Sbjct: 704 GHVNDWAVEFLKLIEDDVFTTFIQVLHYKLHNDPWRRHQVGLKKKFGLPDQCLLS 758 >gb|EPS66708.1| adenylosuccinate synthetase, partial [Genlisea aurea] Length = 316 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/56 (53%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWR--IDSAPPKKDFGLPKECLV 165 GL E+WA +F +++ DD F TLVQILHYKLHND WR +S+ K +G+P +C+V Sbjct: 261 GLVEDWAVQFSQLKEDDVFATLVQILHYKLHNDEWRKEFESSKSWKHYGVPAQCVV 316 >ref|NP_974452.1| exostosin family protein [Arabidopsis thaliana] gi|110740929|dbj|BAE98560.1| hypothetical protein [Arabidopsis thaliana] gi|332646160|gb|AEE79681.1| exostosin family protein [Arabidopsis thaliana] Length = 791 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/54 (53%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPK-KDFGLPKECL 162 G E+WA +F +++ DD F T++Q LH+KLHNDPWR + A + KD+GLP+ECL Sbjct: 734 GHEEDWAVQFSKLKHDDIFATIIQTLHFKLHNDPWRREQAVNRTKDYGLPQECL 787 >ref|XP_003519065.1| PREDICTED: uncharacterized protein LOC100783624 [Glycine max] Length = 795 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 1 IGLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLVT 168 IG ++WA +F ++ DD F TL+QILHYKLHNDPWR K FGLP +CLV+ Sbjct: 739 IGHVDDWAVEFLKLTEDDVFVTLIQILHYKLHNDPWR-KQVRHNKHFGLPHQCLVS 793 >ref|NP_191322.3| exostosin family protein [Arabidopsis thaliana] gi|44917463|gb|AAS49056.1| At3g57630 [Arabidopsis thaliana] gi|46931284|gb|AAT06446.1| At3g57630 [Arabidopsis thaliana] gi|332646159|gb|AEE79680.1| exostosin family protein [Arabidopsis thaliana] gi|591401994|gb|AHL38724.1| glycosyltransferase, partial [Arabidopsis thaliana] Length = 793 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/54 (53%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPK-KDFGLPKECL 162 G E+WA +F +++ DD F T++Q LH+KLHNDPWR + A + KD+GLP+ECL Sbjct: 736 GHEEDWAVQFSKLKHDDIFATIIQTLHFKLHNDPWRREQAVNRTKDYGLPQECL 789 >emb|CAB41192.1| putative protein [Arabidopsis thaliana] Length = 736 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/54 (53%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPK-KDFGLPKECL 162 G E+WA +F +++ DD F T++Q LH+KLHNDPWR + A + KD+GLP+ECL Sbjct: 679 GHEEDWAVQFSKLKHDDIFATIIQTLHFKLHNDPWRREQAVNRTKDYGLPQECL 732 >ref|XP_004307567.1| PREDICTED: uncharacterized protein LOC101304329 [Fragaria vesca subsp. vesca] Length = 791 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLV 165 G +WA +F ++ DD F T VQ+LHYKLHNDPWR KK+FGLP+ECL+ Sbjct: 736 GRMGDWAVQFSQLIEDDVFQTFVQVLHYKLHNDPWR-QHVRVKKEFGLPQECLI 788 >gb|EPS66816.1| hypothetical protein M569_07961, partial [Genlisea aurea] Length = 184 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/53 (56%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPK-KDFGLPKEC 159 G+ E+WA +F +I GDD F TL+QILHYKLHND WR + K K+FG+P C Sbjct: 132 GVVEDWAVQFSQIHGDDVFATLMQILHYKLHNDKWRQEFLYRKEKNFGVPPNC 184 >ref|XP_007201939.1| hypothetical protein PRUPE_ppa001595mg [Prunus persica] gi|462397470|gb|EMJ03138.1| hypothetical protein PRUPE_ppa001595mg [Prunus persica] Length = 795 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = +1 Query: 4 GLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECL 162 G E+WA +F ++ DD T VQ+LHYKLHNDPWR KK+FGLP+ECL Sbjct: 740 GHMEDWAAQFSQLIEDDVVATFVQVLHYKLHNDPWR-QHVHVKKEFGLPQECL 791 >ref|XP_003535163.1| PREDICTED: uncharacterized protein LOC100807663 [Glycine max] Length = 795 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 1 IGLTENWATKFHEIEGDDAFTTLVQILHYKLHNDPWRIDSAPPKKDFGLPKECLVT 168 IG ++WA +F ++ DDAF TL+QILHYKLHND WR K FGLP +CLV+ Sbjct: 739 IGHVDDWAVEFLKLTEDDAFATLIQILHYKLHNDRWR-KQVRHNKQFGLPHQCLVS 793