BLASTX nr result
ID: Mentha25_contig00030363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00030363 (816 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28653.1| hypothetical protein MIMGU_mgv1a008509mg [Mimulus... 60 7e-07 gb|EPS59438.1| hypothetical protein M569_15370, partial [Genlise... 58 4e-06 >gb|EYU28653.1| hypothetical protein MIMGU_mgv1a008509mg [Mimulus guttatus] Length = 371 Score = 60.5 bits (145), Expect = 7e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -2 Query: 815 LLHWPLTIFRAVQLATSESLLPEISNELRIHYLG 714 LLHWPLT++ A+QLAT ++LLP+ISNELRIHYLG Sbjct: 153 LLHWPLTVYWAIQLATIKNLLPQISNELRIHYLG 186 >gb|EPS59438.1| hypothetical protein M569_15370, partial [Genlisea aurea] Length = 276 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 815 LLHWPLTIFRAVQLATSESLLPEISNELRIHYLG 714 +LHWPLT++ A+QLAT +LLPEI NELRIHYLG Sbjct: 158 ILHWPLTVYWAIQLATGCNLLPEIKNELRIHYLG 191