BLASTX nr result
ID: Mentha25_contig00030242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00030242 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABX60975.1| TPK1 [Nicotiana tabacum] 66 6e-09 ref|XP_007025166.1| Ca2+ activated outward rectifying K+ channel... 64 3e-08 emb|CBI30826.3| unnamed protein product [Vitis vinifera] 64 4e-08 ref|XP_002272049.1| PREDICTED: probable calcium-activated outwar... 64 4e-08 ref|XP_002317301.1| calcium-activated outward-rectifying potassi... 62 1e-07 gb|EYU28176.1| hypothetical protein MIMGU_mgv1a006396mg [Mimulus... 62 2e-07 ref|XP_006355603.1| PREDICTED: two-pore potassium channel 3-like... 60 6e-07 ref|XP_003577960.1| PREDICTED: two pore potassium channel c-like... 60 6e-07 ref|XP_002462155.1| hypothetical protein SORBIDRAFT_02g020740 [S... 59 8e-07 ref|XP_006660519.1| PREDICTED: LOW QUALITY PROTEIN: two pore pot... 59 1e-06 ref|XP_004956520.1| PREDICTED: two pore potassium channel c-like... 59 1e-06 ref|XP_006369892.1| calcium-activated outward-rectifying potassi... 58 2e-06 ref|XP_002519734.1| Calcium-activated outward-rectifying potassi... 58 2e-06 tpg|DAA60959.1| TPA: hypothetical protein ZEAMMB73_628622 [Zea m... 57 3e-06 ref|XP_004232994.1| PREDICTED: two-pore potassium channel 3-like... 57 4e-06 ref|XP_006585015.1| PREDICTED: two-pore potassium channel 3-like... 56 6e-06 ref|XP_006585014.1| PREDICTED: two-pore potassium channel 3-like... 56 6e-06 ref|XP_004504708.1| PREDICTED: two-pore potassium channel 3-like... 56 6e-06 ref|XP_003531079.1| PREDICTED: two-pore potassium channel 3-like... 56 6e-06 sp|Q69TN4.1|KCO3_ORYSJ RecName: Full=Two pore potassium channel ... 56 8e-06 >gb|ABX60975.1| TPK1 [Nicotiana tabacum] Length = 428 Score = 66.2 bits (160), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHHH 490 +KD+ ICKQFERLDAGNCG+ITLADLMESHHH Sbjct: 396 DKDVMLICKQFERLDAGNCGRITLADLMESHHH 428 >ref|XP_007025166.1| Ca2+ activated outward rectifying K+ channel 6 isoform 1 [Theobroma cacao] gi|508780532|gb|EOY27788.1| Ca2+ activated outward rectifying K+ channel 6 isoform 1 [Theobroma cacao] Length = 532 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI QIC++F+RLDAGNCGKITLADLMESHH Sbjct: 501 EKDILQICEKFDRLDAGNCGKITLADLMESHH 532 >emb|CBI30826.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDISQIC +F+RLD+GNCGKITLADLME+HH Sbjct: 281 EKDISQICNKFDRLDSGNCGKITLADLMENHH 312 >ref|XP_002272049.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 6-like [Vitis vinifera] Length = 509 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDISQIC +F+RLD+GNCGKITLADLME+HH Sbjct: 478 EKDISQICNKFDRLDSGNCGKITLADLMENHH 509 >ref|XP_002317301.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] gi|222860366|gb|EEE97913.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] Length = 428 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESH 496 EKDI QIC+QFERLD GNCGKITLADLMESH Sbjct: 397 EKDILQICQQFERLDTGNCGKITLADLMESH 427 >gb|EYU28176.1| hypothetical protein MIMGU_mgv1a006396mg [Mimulus guttatus] Length = 445 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 E DI QICKQFERLDAGNCGKI+L DLME+HH Sbjct: 414 ETDILQICKQFERLDAGNCGKISLTDLMENHH 445 >ref|XP_006355603.1| PREDICTED: two-pore potassium channel 3-like [Solanum tuberosum] Length = 424 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKD+ ICKQFERLD+GNCG+ITL DLME HH Sbjct: 393 EKDVMLICKQFERLDSGNCGRITLGDLMEHHH 424 >ref|XP_003577960.1| PREDICTED: two pore potassium channel c-like [Brachypodium distachyon] Length = 461 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI IC+QF+RLD+GNCGKITL+DL++SHH Sbjct: 416 EKDIKMICEQFQRLDSGNCGKITLSDLLQSHH 447 >ref|XP_002462155.1| hypothetical protein SORBIDRAFT_02g020740 [Sorghum bicolor] gi|241925532|gb|EER98676.1| hypothetical protein SORBIDRAFT_02g020740 [Sorghum bicolor] Length = 468 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI IC QF+RLD GNCGKITL+DL+ESHH Sbjct: 423 EKDIMMICDQFQRLDTGNCGKITLSDLLESHH 454 >ref|XP_006660519.1| PREDICTED: LOW QUALITY PROTEIN: two pore potassium channel c-like [Oryza brachyantha] Length = 452 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI IC QF+RLD GNCGKITL+DL+ESHH Sbjct: 407 EKDIIMICDQFQRLDTGNCGKITLSDLLESHH 438 >ref|XP_004956520.1| PREDICTED: two pore potassium channel c-like [Setaria italica] Length = 460 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI +C QF+RLD GNCGKITL+DL+ESHH Sbjct: 415 EKDIMMVCDQFQRLDTGNCGKITLSDLLESHH 446 >ref|XP_006369892.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] gi|550348861|gb|ERP66461.1| calcium-activated outward-rectifying potassium channel 3 family protein [Populus trichocarpa] Length = 433 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMES 499 EKDI QIC+QF+RLD GNCGKITLADLMES Sbjct: 402 EKDILQICQQFDRLDTGNCGKITLADLMES 431 >ref|XP_002519734.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223541151|gb|EEF42707.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 426 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESH 496 EKD+ QIC+ F+R+DAGNCGKITLADLME+H Sbjct: 395 EKDVLQICQTFDRIDAGNCGKITLADLMETH 425 >tpg|DAA60959.1| TPA: hypothetical protein ZEAMMB73_628622 [Zea mays] Length = 463 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI IC QF+RLD G+CGKITL+DL+ESHH Sbjct: 418 EKDIMMICDQFQRLDTGSCGKITLSDLLESHH 449 >ref|XP_004232994.1| PREDICTED: two-pore potassium channel 3-like [Solanum lycopersicum] Length = 424 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKD+ ICKQFERLD+GNCG+ITL DLME +H Sbjct: 393 EKDVMLICKQFERLDSGNCGRITLGDLMEHNH 424 >ref|XP_006585015.1| PREDICTED: two-pore potassium channel 3-like isoform X3 [Glycine max] Length = 445 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI Q+ ++F+RLDAGNCGKITLADLME+H+ Sbjct: 414 EKDIMQVSEKFDRLDAGNCGKITLADLMENHN 445 >ref|XP_006585014.1| PREDICTED: two-pore potassium channel 3-like isoform X2 [Glycine max] Length = 449 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI Q+ ++F+RLDAGNCGKITLADLME+H+ Sbjct: 418 EKDIMQVSEKFDRLDAGNCGKITLADLMENHN 449 >ref|XP_004504708.1| PREDICTED: two-pore potassium channel 3-like isoform X1 [Cicer arietinum] Length = 428 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI QI ++F+RLD GNCGKITLADLMESH+ Sbjct: 397 EKDIMQISEKFDRLDTGNCGKITLADLMESHN 428 >ref|XP_003531079.1| PREDICTED: two-pore potassium channel 3-like isoform X1 [Glycine max] Length = 430 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESHH 493 EKDI Q+ ++F+RLDAGNCGKITLADLME+H+ Sbjct: 399 EKDIMQVSEKFDRLDAGNCGKITLADLMENHN 430 >sp|Q69TN4.1|KCO3_ORYSJ RecName: Full=Two pore potassium channel c; Short=Two K(+) channel c; AltName: Full=Calcium-activated outward-rectifying potassium channel 3; Short=OsKCO3 gi|50725050|dbj|BAD33183.1| putative outward-rectifying potassium channel KCO1 [Oryza sativa Japonica Group] gi|125605102|gb|EAZ44138.1| hypothetical protein OsJ_28764 [Oryza sativa Japonica Group] Length = 456 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 588 EKDISQICKQFERLDAGNCGKITLADLMESH 496 EKDI IC QF+R+D+GNCGKITL+DL+ESH Sbjct: 411 EKDIMMICDQFQRMDSGNCGKITLSDLLESH 441